@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q2FXI1_STAA8_: (2019-02-05 )
MAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIETGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKINASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEGAMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQKRYKDMNTWLKFLNEVMNSNMFI

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MES_A_2(4R78)
?
[Raw transfer]




GMP_A_2(5IGI)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




49 HHSearch 72.9717% -3 - C3 -2QG7 - ? -
48 HHSearch 70.9817% 9 * C3 *2QG7 - ? -
46 HHSearch 70.0222% 13 - C3 -1NW1 - CKA2_CAEEL -
45 HHSearch 69.8122% 11 - C3 -1NW1 - CKA2_CAEEL -
59 SP3 68.3913% 22 - C3 -1ND4 - KKA2_KLEPN -
54 HHSearch 68.0516% 5 - C3 -2PPQ - KHSE_AGRFC -
44 HHSearch 66.3418% 22 - C3 -5IGI 4.1 ?
51 HHSearch 65.8818% -29 - C3 -3DXQ - ? -
31 Fugue 65.2415% 11 - C3 -1ZYL - SRKA_ECOLI -
36 Fugue 65.0314% 6 - C3 -3JR1 - ? -
41 HHSearch 64.9919% 26 - C3 -4R78 2.6 ?
43 HHSearch 64.5818% 17 - C3 -5IGH - ? -
50 HHSearch 63.7518% -6 - C- -3DXQ - ? -
42 HHSearch 63.0719% 34 - C3 -4R7B - ? -
21 Fugue 62.6014% -5 - C3 -2QG7 - ? -
23 Fugue 62.2418% 9 - C3 -1NW1 - CKA2_CAEEL -
58 SP3 61.8019% 14 - C3 -1NW1 - CKA2_CAEEL -
53 HHSearch 58.7512% 15 - C3 -5IQC - AACA_STAAU -
47 HHSearch 58.6611% 13 - C3 -3TDW - ? -
56 HHSearch 57.7411% -3 - C3 -5IWU - ? -
55 HHSearch 50.7416% -4 - C3 -3CSV 2.7 ?