@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A1T6B2_MYCVP: (2019-01-25 )
MSVELAPALEEVLRPVLGDVTVENLQRLTGGASRTTWAFSAHARSRSGTAHARSESDTAHARSESDTAQTGGAGRPLILRTGARDDIHASMELEAKVQQRAAAAGAPVPHIVNADNSPAAVGAPYLICDAIAGETIVRRIFRGLDDGGRARLLEQCATALAAIHRADPAGIGLTSPDDLAGWRSRLDEIGDTTATFEWTFRRLADARPEPSPMRLVHGDFRMGNLIVDESGLAAVLDWELTHIGEIYEDLAWFCIRAWRFGAPETLGAGGLGSVETFLQAYESAADTSLDRNTFRWWLTVATLRWGVICRHQAERHLSGESPSVELAAIGRRVSETEWDLLELLSGGGPR

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




101 HHSearch 80.8420% -11 - C2 -3DXP - ? -
83 Fugue 74.9715% -13 - C2 -2PPQ - KHSE_AGRFC -
76 Fugue 70.8318% -7 - C2 -3ATS - Y3168_MYCTU -
118 HHSearch 70.6019% -57 - C2 -1ND4 - KKA2_KLEPN -
80 Fugue 70.4213% -62 - C2 -3HAM - ? -
106 HHSearch 70.0119% -29 - C2 -3ATT 4.5 Y3168_MYCTU
105 HHSearch 69.9919% -30 - C2 -3ATS - Y3168_MYCTU -
109 HHSearch 69.1716% -57 - C2 -2PPQ - KHSE_AGRFC -
1 PsiBlast_PDB 67.8521% -53 - C1 -3DXP - ? -
77 Fugue 64.7721% -3 - C2 -3DXP - ? -
91 SP3 63.2610% -55 - C2 -1ND4 - KKA2_KLEPN -
82 Fugue 62.5418% 14 - C2 -3CSV 2.8 ?
114 HHSearch 62.2515% -25 - C2 -5IQC - AACA_STAAU -
103 HHSearch 62.1216% -14 - C2 -1NW1 - CKA2_CAEEL -
117 HHSearch 61.6118% -32 - C2 -5IGI - ? -
102 HHSearch 61.3316% -14 - C2 -1NW1 - CKA2_CAEEL -
116 HHSearch 61.2818% -29 - C2 -5IGH - ? -
112 HHSearch 60.7517% -37 - C2 -5IQI - AACA_STAAU -
110 HHSearch 59.5116% -17 - C2 -4R78 3.5 ?
107 HHSearch 58.3813% -20 - C- -3N4U - ? -
113 HHSearch 53.1518% -26 - C2 -6EF6 3.9 ?
115 HHSearch 46.0416% -20 - C2 -3CSV 2.8 ?