@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A3JGG7_9ALTE: (2019-01-25 )
MSTSQGEMRGRLRSNASSTGILSSNTYAKHTLKCSLKPEAMELIRCRHLNIQTTHVKAIELVSFNEAKNRLITKKVIGKELFHALWNPTNLLGRLQGHRLQNPDTLVHRITEIGTWLRKYHNSSAGLTPESTDGSWLVTAFAQKIRGIRASKLIPEPNLKKIEQKYSTELQKLTTPDYLSFNNAFPCQVHGDFVLYNVLVDSQQNMHILDFSKTRISSNLEDVARFYSTLWAIAQTNRTRRSLLRELPTRFLKAYGLPPLIAETPYFRANLVYNFLAHLEAQHRGRKTFSWNTNREMGQITRAGMKWIYQQI

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MES_B_5(3I1A)
?
[Raw transfer]




GNP_C_13(5IQI)
AACA_STAAU
[Raw transfer]




B31_A_3(3TM0)
KKA3_ENTFL
[Raw transfer]




ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




KAN_A_9(1ND4)
KKA2_KLEPN
[Raw transfer]




ZIT_A_3(5IGI)
?
[Raw transfer]




KAN_A_5(1L8T)
KKA3_ENTFL
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




50 Fugue 68.8713% -34 * C7 *2PPQ - KHSE_AGRFC -
49 Fugue 67.5211% 17 - C7 -1ZYL - SRKA_ECOLI -
64 SP3 63.4813% -38 - C7 -1ND4 - KKA2_KLEPN -
1 PsiBlast_PDB 59.4122% -35 - C7 -4FEV - ? -
6 PsiBlast_PDB 59.2022% -35 - C7 -4GKH - ? -
7 PsiBlast_PDB 59.0322% -34 - C7 -4GKI - ? -
72 SP3 58.7519% 49 - C4 -1NY5 - ? -
3 PsiBlast_PDB 58.7122% -32 - C7 -4EJ7 - ? -
65 SP3 58.5814% 40 - C7 -1NW1 - CKA2_CAEEL -
5 PsiBlast_PDB 58.4922% -34 - C7 -4FEW - ? -
48 Fugue 58.2011% 18 - C7 -2Q83 - COTI_BACSU -
59 Fugue 57.8511% 34 - C7 -1NW1 - CKA2_CAEEL -
4 PsiBlast_PDB 57.0522% -29 - C7 -4FEU - ? -
2 PsiBlast_PDB 56.5722% -28 - C7 -4FEX - ? -
60 Fugue 55.7415% -58 * C5 *4RP9 - ULAA_ECOLI -
54 Fugue 53.9113% 20 - C7 -3DXP - ? -
66 SP3 52.7915% 26 - C7 -1SM2 - ITK_HUMAN -
69 SP3 52.5513% -32 - C7 -1RJB - FLT3_HUMAN -
55 Fugue 51.8611% 11 - C7 -3HAM - ? -
70 SP3 51.3719% 13 - C3 -1D0C - NOS3_BOVIN -
46 HHSearch 36.6516% 46 - C7 -5IQI 5.5 AACA_STAAU
43 HHSearch 33.5626%-135 - C7 -5IGI 2.9 ?
47 HHSearch 30.3926%-103 - C7 -1ND4 3.0 KKA2_KLEPN
38 HHSearch 30.2118% -94 - C7 -3I1A 3.2 ?
29 HHSearch 28.8924% -92 - C7 -6EF6 3.8 ?
45 HHSearch 28.5519% -87 - C7 -3ATT 3.6 Y3168_MYCTU
34 HHSearch 27.8317%-111 - C7 -1L8T 2.7 KKA3_ENTFL
33 HHSearch 25.3617% -98 - C7 -3TM0 2.9 KKA3_ENTFL