@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A3JM04_9RHOB: (2019-01-25 )
MTGHGMAGDDWQYRKTMPQNILRPTVEAALPHVAGAEWEPLAGGRTNPVFKINADAPLVCKLSCLSGETPLFGNRALDEAAILKHLEGSGLAPSLTDVLAVPEGEILIYSFVEGDILTQTIPAAVRILRQVHQAEIPDNLPRLDGSSAAIIQKTKAILETLPVQKAMAISFAEPKVELPDTLVPRLIHGDPVPANFIQSKGKLTLIDWQCPAIGDPCEDLAIALSPAMNAVYGDGPLTPQQMKECLNAYGDRTVSDRYRKLAPLFHWRMAAYCAWKVEQGDKDYAAGVKLELAALK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_2(3TDW)
?
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




KAN_A_9(1ND4)
KKA2_KLEPN
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




UNL_A_2(3F7W)
?
[Raw transfer]




62 HHSearch 80.7918% -7 - C- -3N4U - ? -
64 HHSearch 75.4317% -42 - C4 -3TDW 5.3 ?
59 HHSearch 74.4319% -14 - C4 -3CSV 3.0 ?
27 Fugue 72.0316% -13 - C4 -2PPQ - KHSE_AGRFC -
49 HHSearch 71.8916% -18 - C4 -1NW1 - CKA2_CAEEL -
67 HHSearch 71.8015% -10 - C4 -2QG7 - ? -
48 HHSearch 71.5616% -20 - C4 -1NW1 - CKA2_CAEEL -
51 HHSearch 71.1614% -25 - C4 -3C5I - ? -
22 Fugue 68.8914% -0 - C4 -2QG7 - ? -
53 HHSearch 67.8316% -14 - C4 -3DXQ - ? -
32 Fugue 67.7316% -10 - C4 -1ZYL - SRKA_ECOLI -
8 PsiBlast_PDB 67.4424% -9 - C4 -1ND4 - KKA2_KLEPN -
63 HHSearch 67.3919% -28 - C4 -2PPQ - KHSE_AGRFC -
38 SP3 66.8818% -3 - C4 -1ND4 2.9 KKA2_KLEPN
66 HHSearch 66.2515% -19 - C4 -2QG7 - ? -
55 HHSearch 65.7022% 30 - C4 -4R78 3.4 ?
26 Fugue 65.1416% -13 - C4 -3HAM - ? -
54 HHSearch 64.6622% 32 * C4 *4R7B - ? -
61 HHSearch 64.6414% -5 - C4 -5FTG - CHKA_HUMAN -
24 Fugue 64.6413% -3 - C4 -3I1A - ? -
70 HHSearch 45.4118% 11 - C4 -3F7W 2.9 ?