@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A3SHE0_ROSNI: (2019-01-25 )
MPLGPEGVTRGWLGAALGRDVSDLRLVRVGVDEGFTGTRLYRAEIGGGASVIVKLASEDAALRARFAAENAREVAFYHHYAEGLPVPRCYHAASDAEAGASVVVLEDLGGARSVPFVTGLSRDEAEAAVRALARCHAAHWGAAGLADLPGASVAQELGFAACWDGYAQALQGLLPGADLSPEVLALGAAMARDAAAVLGPILDDGVLTLRHGDVQADNLMFDGPGAVLLDWQFMARGRGGSDLAYLLISSLEPEVRRAHEAALIACYLNALQEQGIAYEHAALWRDYRRGVAVKLLMSVVATVGMDNQGAAKQAWRRADLARLLAFAADHGAGEAA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_2(4DCA)
?
[Raw transfer]




ADP_A_6(2OLC)
MTNK_BACSU
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




36 Fugue 76.6416% -38 - C4 -2OLC 3.4 MTNK_BACSU
40 Fugue 72.2412% -21 - C4 -3I1A - ? -
39 Fugue 71.9315% -61 - C4 -1J7L - KKA3_ENTFL -
35 Fugue 71.1815% -17 - C4 -3ATS - Y3168_MYCTU -
44 Fugue 68.9015% -31 * C4 *2PPQ - KHSE_AGRFC -
37 Fugue 68.3216% -28 - C4 -1ZYL - SRKA_ECOLI -
5 HHSearch 61.3215% -29 - C4 -3ATT - Y3168_MYCTU -
6 HHSearch 60.8715% -26 - C4 -3ATS - Y3168_MYCTU -
12 HHSearch 60.4317% -36 - C4 -2PPQ - KHSE_AGRFC -
11 HHSearch 59.2518% -40 - C4 -5UXD - ? -
26 SP3 58.4510% -33 - C4 -1J7L - KKA3_ENTFL -
25 SP3 55.8612% -8 - C4 -1ND4 - KKA2_KLEPN -
3 HHSearch 55.7014% -18 - C4 -2PUL - MTNK_BACSU -
16 HHSearch 55.2415% -30 - C4 -4DCA 3.3 ?
22 HHSearch 54.0416% -36 - C- -3N4U - ? -
2 HHSearch 53.6114% -18 - C4 -2OLC - MTNK_BACSU -
42 Fugue 53.2612% -31 - C4 -2Q83 - COTI_BACSU -
27 SP3 53.0011% 7 - C4 -1NW1 - CKA2_CAEEL -
48 Fugue 52.4316% -7 - C4 -3CSV - ? -
46 Fugue 52.0013% -10 - C4 -3JR1 - ? -
13 HHSearch 51.7818% -23 - C4 -6EF6 0.9 ?