@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A3TLW1_9MICO: (2019-01-25 )
MPTLFEGETPVDLDTVGSFVAQQCPQWGHLPLRAMTTSGTEHTTYRLGDELLVRVPRDASSEAGLRKEIDWLPRLRDGVDLEMPVIEHVGAPSLDYPHTWTINRWVSGEDASARVLAGDVPSSWADVLAELVASLRAVDLREFAPHELPQGQRGGHVRCRVEALHGQTDPMSGPLDPTPVMGLMEAALDAGAPAPEPVLLHGDLIPGNLVVRNGRLSGLLDFGTLTTGYAAWDLTPAWWVLDRSGRERFRELLEVDDVSWAWGRAFAASQGLLADWVYAPRGHALAPLGARAVAEALAD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_2(3TDW)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




141 HHSearch 79.4318% -40 - C3 -3TDW 3.9 ?
139 HHSearch 76.4513% -39 - C- -3N4U - ? -
142 HHSearch 75.1718% -22 - C3 -5UXD - ? -
146 HHSearch 74.8318% -19 - C3 -5IGI - ? -
145 HHSearch 73.9918% -17 - C3 -5IGH - ? -
149 HHSearch 70.7119% -12 - C3 -6EF6 3.8 ?
160 Fugue 65.5015% -3 - C3 -3HAM - ? -
150 HHSearch 64.7512% 6 - C3 -3JR1 - ? -
151 HHSearch 63.2214% -11 - C3 -4DCA - ? -
173 Fugue 62.7112% 13 - C3 -3JR1 - ? -
148 HHSearch 62.1412% -17 - C3 -5IWU - ? -
147 HHSearch 61.6612% -17 - C3 -5UXA - ? -
144 HHSearch 61.4110% -10 * C3 *5IQC - AACA_STAAU -
165 Fugue 61.0915% -3 - C3 -1ZYL - SRKA_ECOLI -
175 Fugue 60.5420% -49 - C3 -4WW7 - BUD32_YEAST -
166 Fugue 60.3913% 13 - C3 -3ATS - Y3168_MYCTU -
143 HHSearch 60.3810% -14 - C3 -5IQI - AACA_STAAU -
163 Fugue 59.8216% -5 - C3 -2PPQ - KHSE_AGRFC -
152 HHSearch 58.2915% 4 - C3 -3HAM - ? -
155 HHSearch 56.7814% -6 - C3 -1NW1 - CKA2_CAEEL -