@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A3TRE0_9MICO: (2019-01-25 )
MDDFAEWVRVAFGLGEGPLVRTVGGRGADGDVWHLRVRDREYAVKRPFRAFDPAAVRHEAALLEHLTSGGVEVPTHVASPEGQLVVEVPDHLGGGNARVSHWVTGTSVTDRTSEVAEQLGTLLAQLHRAAPATWDRPRSWHTAMVPPDEWAELVRRSSGQPWHQALVARHDDLTAYAEVVDRAGPGTGPFVLGHCDLHPDNALAAPDGSLRALDWEDCGPVDPTRELAKTLVQWHVLGESVDDDAITKTVAAYRDAGGPGLLADTPDFAMVLCSETNFLANQVRLALDVSAPGERRDQARGEITEALADYLPSIAALERVLSVTRPG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




HIS_A_2(4PDY)
?
[Raw transfer]




ZIT_A_3(5IGI)
?
[Raw transfer]




MES_B_5(3I1A)
?
[Raw transfer]




EDO_A_14(3CSV)
?
[Raw transfer]




42 HHSearch 85.6518% -36 - C5 -2Q83 3.7 COTI_BACSU
41 HHSearch 83.6715% -66 - C5 -2PPQ - KHSE_AGRFC -
39 Fugue 78.4019% 17 - C5 -4OCV - ? -
49 HHSearch 75.1821% -12 - C5 -5IGH - ? -
44 HHSearch 72.4919% 8 - C5 -4PDY 2.5 ?
50 HHSearch 72.0020% -11 - C5 -5UXD - ? -
40 HHSearch 70.7816% -12 - C5 -6EF6 3.0 ?
48 HHSearch 70.6921% -6 - C5 -5IGI 3.2 ?
57 HHSearch 70.0314% -7 - C5 -4WH3 - NAHK_BIFL2 -
46 HHSearch 69.3414% -0 - C5 -4OCV - ? -
24 Fugue 68.2614% 18 - C5 -1ZYL - SRKA_ECOLI -
45 HHSearch 68.0815% -9 - C5 -3I1A 3.1 ?
35 Fugue 66.8014% 9 - C5 -3ATS - Y3168_MYCTU -
27 Fugue 66.2613% 24 * C5 *2PPQ - KHSE_AGRFC -
32 Fugue 65.2313% 42 - C5 -3I1A - ? -
51 HHSearch 59.6314% 17 - C5 -4R78 - ? -
62 SP3 58.7011% 30 - C5 -1NW1 - CKA2_CAEEL -
26 Fugue 58.3312% -9 - C5 -3HAM - ? -
60 SP3 57.409% -5 - C5 -1ND4 - KKA2_KLEPN -
52 HHSearch 56.4514% 20 - C5 -4R7B - ? -
47 HHSearch 49.5715% 21 - C5 -3CSV 2.9 ?