@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A4BIV1_9GAMM: (2019-01-25 )
MSVYTELSEQDVMHLLADYDLGVYVRHQGISAGVENTNYFVSTDQHELVLTVFEKHSADELPFFLQLGEHLHARHCKVPQPFRDRDGQFLQIVKGKPAVFIERLTGQHVQASPACALKIAQALADIHNATLSFQTDQRHSHNRGWIERQASRVLPSLSAPDQQLMNAALAIIRAIPDDLPEGVIHADLFHDNALFDGNEVAGIIDWYFAGRDSYALDIAITMNDWCLDTQHQVDPEQCAAFIERYHQRRSLSSAERNALPKLQVQSALRFWISRLLAQAEHGESNDSITVKDPIPMREQCRQLLTRVREPGNEHR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_3(4OCV)
?
[Raw transfer]




GMP_A_2(5IGI)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




HIS_A_2(4PDY)
?
[Raw transfer]




ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




MES_A_2(4R78)
?
[Raw transfer]




ACY_A_10(4WH3)
NAHK_BIFL2
[Raw transfer]




21 HHSearch 88.1134% -31 - C2 -2PPQ - KHSE_AGRFC -
1 PsiBlast_PDB 86.0436% -59 - C2 -2PPQ - KHSE_AGRFC -
42 Fugue 83.6532% -14 - C2 -2PPQ - KHSE_AGRFC -
24 HHSearch 58.7915% -67 - C2 -2Q83 3.5 COTI_BACSU
43 Fugue 55.8415% 9 - C2 -1ZYL - SRKA_ECOLI -
59 SP3 54.3615% 1 - C2 -1NW1 - CKA2_CAEEL -
54 Fugue 53.7818% 16 - C2 -4OCV 4.5 ?
23 HHSearch 53.7621% -7 - C2 -6EF6 3.7 ?
47 Fugue 52.1413% 9 - C2 -1NW1 - CKA2_CAEEL -
26 HHSearch 51.7116% -12 - C2 -1ZYL - SRKA_ECOLI -
52 Fugue 50.0513% -12 - C2 -3JR1 - ? -
25 HHSearch 49.6616% 11 - C2 -4OCV - ? -
28 HHSearch 49.4619% -31 - C2 -5IGI 5.1 ?
49 Fugue 49.0813% 3 - C2 -2QG7 - ? -
22 HHSearch 48.6917% -28 - C2 -4PDY 3.1 ?
27 HHSearch 46.0817% 5 - C2 -4WH3 0.8 NAHK_BIFL2
40 HHSearch 45.3318% 7 - C2 -1NW1 - CKA2_CAEEL -
41 HHSearch 44.2318% 12 - C2 -1NW1 - CKA2_CAEEL -
45 Fugue 43.6614% -21 - C2 -3ATS - Y3168_MYCTU -
39 HHSearch 41.2214% -26 - C2 -5UXD - ? -
32 HHSearch 36.4815% 17 - C2 -4R78 2.8 ?