@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A6CIE6_9BACI: (2019-01-26 )
MNQAQFEKVIEVLFPDIIIQEVTAYEKGWDNDIFIVNKEIVFRFPRSEEVASKVKDEIILLKHLAHKEPKLDIPRYKGIEMDGNLKCVKYNFMKGKSLSEIKNSRLDLHSAELLGDFLSRLHSIELSALKETNITSFHTDTYWENLYESAKTYVFPNITHSERAEIQQFYEDFSNNPIYSNVNKAVIHGDLTAANILYNKEEECVSGIIDFTDAQIADPAFDFAGLYWAYGPEFTKKLLTYYDGKDKTGIFERVQSFYGLQPIFHELIYAVKENHDVDWGSALERFQYLNSHR

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GNP_C_13(5IQI)
AACA_STAAU
[Raw transfer]




GNP_A_5(5IQC)
AACA_STAAU
[Raw transfer]




ADP_A_5(4N57)
?
[Raw transfer]




GDP_B_7(3TDV)
?
[Raw transfer]




GDP_A_2(3TDW)
?
[Raw transfer]




GDP_A_2(3TDW)
?
[Raw transfer]




TOY_A_3(3SG8)
?
[Raw transfer]




GDP_A_3(3TDV)
?
[Raw transfer]




ANP_A_3(4OCV)
?
[Raw transfer]




GMP_A_3(4DT9)
?
[Raw transfer]




ERY_A_5(5IWU)
?
[Raw transfer]




ADN_A_3(4DT8)
?
[Raw transfer]




ADP_A_2(4DCA)
?
[Raw transfer]




KAN_A_3(3SG9)
?
[Raw transfer]




KAN_A_3(4DFU)
?
[Raw transfer]




GOL_A_5(3HAM)
?
[Raw transfer]




GMP_B_5(4DTB)
?
[Raw transfer]




GOL_A_5(3HAM)
?
[Raw transfer]




GMP_A_3(4DTB)
?
[Raw transfer]




MES_B_5(3I1A)
?
[Raw transfer]




KAN_A_3(4DFB)
?
[Raw transfer]




ADN_B_4(4DTA)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




ADN_A_3(4DTA)
?
[Raw transfer]




MES_A_3(3I1A)
?
[Raw transfer]




GMP_A_2(5IGI)
?
[Raw transfer]




4 PsiBlast_PDB 78.0631% -3 - C1 -3TDW 1.0 ?
21 Blastp_CBE 77.7331% -0 - C1 -3TDV 1.8 ?
6 PsiBlast_PDB 77.5731% -5 - C1 -3TDV Error ?
45 HHSearch 76.1327% -29 * C1 *3TDW 1.0 ?
46 HHSearch 73.9827% -28 - C- -3N4U - ? -
14 PsiBlast_PDB 73.1630% -20 - C1 -6CD7 - ? -
22 Blastp_CBE 71.9931% -17 - C1 -4DTB Error ?
12 PsiBlast_PDB 71.8530% -19 - C1 -4DT8 3.0 ?
23 Blastp_CBE 71.1631% -25 - C1 -4DTA 4.5 ?
5 PsiBlast_PDB 71.1630% -16 - C1 -4DTB Error ?
16 PsiBlast_PDB 70.4030% -22 - C1 -4DTA 3.3 ?
13 PsiBlast_PDB 70.2130% -15 - C1 -4DT9 2.2 ?
11 PsiBlast_PDB 69.5330% -15 - C- -3N4U - ? -
3 PsiBlast_PDB 68.4230% -17 - C1 -5C4L - ? -
7 PsiBlast_PDB 68.0029% -24 - C1 -3SG8 2.6 ?
2 PsiBlast_PDB 67.8130% -22 - C1 -5C4K - ? -
8 PsiBlast_PDB 67.3529% -25 - C1 -3SG9 2.8 ?
20 PsiBlast_PDB 67.1929% -12 - C1 -4DFU 2.6 ?
1 PsiBlast_PDB 67.1130% -22 - C1 -4N57 3.6 ?
49 HHSearch 65.5120% -11 - C1 -5IQC 2.8 AACA_STAAU
48 HHSearch 64.0920% -11 - C1 -5IQI 2.1 AACA_STAAU
19 PsiBlast_PDB 63.6529% -24 - C1 -4DFB 3.1 ?
55 HHSearch 63.2022% -37 - C1 -3HAM 1.7 ?
66 Fugue 62.4420% -13 - C1 -3HAM 1.7 ?
52 HHSearch 61.8720% 3 - C1 -5IGI 4.1 ?
56 HHSearch 61.5322% -16 - C1 -4DCA 5.0 ?
54 HHSearch 58.8018% 15 - C1 -5IWU 5.0 ?
81 Fugue 49.4118% 8 - C1 -4OCV 4.5 ?
62 HHSearch 44.2115% -1 - C1 -6EF6 4.1 ?
61 HHSearch 43.9915% -1 - C1 -3I1A 2.2 ?
68 Fugue 39.2117% 40 - C1 -3I1A 2.4 ?