@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A6FEQ4_9GAMM: (2019-01-26 )
MMKKVPEFVVQFSPESFSLTPVPGGLSNHNYRLQFQQHGLNNRYFVRQFSATYLGMDNDVELEYAAQIQAANIGLAPNVIVKHKQGMICDWVTGEHWDQTAQVRDENIEKLAQLVAMLHQQPMPSHHLDMVERLQHYYQTLNTEFKTVQLAQQLTLVIDLIEQHLPANRLGFCHHDMNPLNFIEDEQAKLYLLDWEFAAAGHCDFDIATLFQTFEWQDAQQALFIRYYNQYYPAAKVTFEQLDVMAVVVEMMTLLWCIVMYQQDKDATYLRLWQQSEYAITDKINRLSKELQWDQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_9(3MES)
?
[Raw transfer]




ADP_A_3(3MES)
?
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




JFN_A_3(6EF6)
?
[Raw transfer]




EDO_A_10(5FTG)
CHKA_HUMAN
[Raw transfer]




40 HHSearch 75.5316% -18 - C1 -2QG7 - ? -
21 Fugue 75.3116% -12 - C1 -1NW1 - CKA2_CAEEL -
39 HHSearch 75.0616% -32 * C1 *2QG7 - ? -
37 HHSearch 74.1916% -22 - C1 -1NW1 - CKA2_CAEEL -
43 HHSearch 73.9720% -25 - C1 -5FTG 3.0 CHKA_HUMAN
52 HHSearch 73.9418% -54 - C1 -3MES 6.6 ?
38 HHSearch 73.2816% -23 - C1 -1NW1 - CKA2_CAEEL -
51 HHSearch 72.6118% -47 - C1 -3MES 7.2 ?
59 SP3 71.7015% -10 - C1 -1NW1 - CKA2_CAEEL -
44 HHSearch 71.5020% -2 - C1 -5FUT - CHKA_HUMAN -
23 Fugue 70.1216% 3 - C1 -2QG7 - ? -
47 HHSearch 67.2417% -26 - C1 -3C5I - ? -
41 HHSearch 67.2019% -8 - C1 -4R7B - ? -
42 HHSearch 66.7619% -12 - C1 -4R78 3.4 ?
50 HHSearch 61.4216% -14 - C1 -3CSV - ? -
53 HHSearch 60.0013% -16 - C1 -2PPQ - KHSE_AGRFC -
54 HHSearch 58.3915% -16 - C1 -6EF6 3.1 ?
46 HHSearch 56.4414% 4 - C1 -3DXQ - ? -
24 Fugue 54.7412% -24 - C1 -3ATS - Y3168_MYCTU -
45 HHSearch 54.5414% 0 - C- -3DXQ - ? -