@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A6FXB4_9DELT: (2019-01-26 )
MRSEALEQFVVEEAGVGAPRGASWSRVDEGQGANRVWRVRWGPGSSVIVKRCGPGRAFVQERRAATRWAPAVADASRGLGHARVLAASQALRCLVFVDAGRGEEQVALSPAAFACAGRYLARLHALPVDERDPVPLVEALARREARWLEGAPELRAVASSLGPGALADADWGPRVPCHRDFQPDNWLWDGRTLTVVDFEHARPDARALDLAKLWTRLDGDVDARANAAFWSAYLGPEPCSPSFLAQLRAGLVLHGLASVAWGRSHDDEAFVAEGERAVALARSGREPPNPRAGTPLASL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BEZ_A_2(6EF6)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




67 HHSearch 74.5714% -7 * C3 *2QG7 - ? -
54 HHSearch 74.4521% -35 - C3 -3DXQ - ? -
53 HHSearch 74.2818% -5 - C3 -4R78 - ? -
52 HHSearch 73.0018% -9 - C3 -4R7B - ? -
60 HHSearch 72.7317% -15 - C3 -1ZYL - SRKA_ECOLI -
51 HHSearch 72.6919% -35 - C3 -6EF6 3.8 ?
66 HHSearch 72.5114% -4 - C3 -2QG7 - ? -
55 HHSearch 70.6521% -26 - C- -3DXQ - ? -
56 HHSearch 69.8819% 5 - C3 -3CSV 2.9 ?
27 Fugue 69.2914% 12 - C3 -2QG7 - ? -
40 SP3 68.1119% 7 - C3 -1NW1 - CKA2_CAEEL -
70 HHSearch 65.9217% -16 - C3 -1NW1 - CKA2_CAEEL -
33 Fugue 65.5517% -2 - C3 -3CSV 2.9 ?
63 HHSearch 64.2017% -35 - C3 -2PPQ - KHSE_AGRFC -
28 Fugue 64.1314% -8 - C3 -2Q83 - COTI_BACSU -
38 Fugue 63.2318% 1 - C3 -4OCV - ? -
58 HHSearch 63.0915% -41 - C3 -5IGI - ? -
25 Fugue 63.0816% 7 - C3 -1ZYL - SRKA_ECOLI -
50 HHSearch 62.8015% -44 - C3 -5UXD - ? -
57 HHSearch 60.9315% -34 - C3 -5IGH - ? -