@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A8LMB5_DINSH: (2019-01-26 )
MTPGDRMMASALGSWTRLAPFAGLDPAAFEAEELWRREDPGQVRIVLRMRGGAGQDLVFKRVFQPQDRGRWAEALDGQRRAVRALMRDPVHVPPAILAEDAETLSTVQDFVPGRTLQDHMLLRFDKPGARAQVLQRAGRFLAAFHGATAEGDKPFNPATMLDYIRALGRRALSGDLTLADPDLFAVLAEGLEAAAQTAAGQPVRVAAQHGDLHARNLIVSGKRATLIDFAQDRSAPVQYDMARLIVDLGARFSGDAAPEATCGLPAADLAALSDGYGRDLSQDACLAFLCRCRVLQDWAALPAVASQRSAFQQERLLQLQKTATRLAAA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_2(3TDW)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




MES_A_2(4R78)
?
[Raw transfer]




ZIT_A_3(5IGI)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




UNL_A_2(3F7W)
?
[Raw transfer]




22 Fugue 76.6614% -1 - C2 -4OCV - ? -
47 SP3 74.6616% 9 - C2 -1NW1 - CKA2_CAEEL -
15 Fugue 67.9013% -2 - C2 -1NW1 - CKA2_CAEEL -
23 Fugue 67.3916% 8 - C2 -3CSV 3.3 ?
16 Fugue 66.8314% -18 - C2 -3ATS - Y3168_MYCTU -
11 Fugue 62.7414% -31 - C2 -2PPQ - KHSE_AGRFC -
37 HHSearch 61.9021% -22 - C2 -3F7W 3.0 ?
19 Fugue 61.8911% -21 - C2 -2OLC - MTNK_BACSU -
10 Fugue 61.0014% -4 - C2 -1ZYL - SRKA_ECOLI -
12 Fugue 60.0812% -39 - C2 -3I1A - ? -
50 SP3 59.4214% 1 - C2 -1B6C - TGFR1_HUMAN -
33 HHSearch 56.9017% -20 - C2 -5UXD - ? -
29 HHSearch 56.5015% 11 - C2 -4R78 1.9 ?
28 HHSearch 56.4115% 9 - C2 -4R7B - ? -
48 SP3 54.6714% 7 - C2 -1ND4 - KKA2_KLEPN -
31 HHSearch 54.5714% -39 - C2 -2PPQ - KHSE_AGRFC -
5 PsiBlast_PDB 54.0826% -27 - C2 -1ZYL - SRKA_ECOLI -
25 HHSearch 53.6418% 24 - C2 -3CSV 3.0 ?
27 HHSearch 51.9214% -7 - C2 -6EF6 - ? -
40 HHSearch 51.8316% -37 - C2 -5IGI 3.0 ?
43 HHSearch 49.4715% -10 - C2 -3TDW 3.2 ?