@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A8M7E1_SALAI: (2019-01-26 )
MIESQAPMLEMLWEPHDPRHALAERFGFSDSESASRWVAAMLDEHWGIRIDSCERILMSGGNALAWVGTPSGRLLAKWSVVLDCFPRLMETARLTNWLHGRGLPVSVPVPTRDGCLQVEVDRVSMGLQREIVGDLLDTGDLNQVRAAGVILAQLQDALAAYPDADQFLAPVVSSKPLTVRVTDWLDSRADHLPMAARDTLRGLVASAPPDRLPRQLVHFDIRSANILWACGGVAAILDFEEAQHDHRIVELARAAVLLGTRYHNWGPVSADVRTEFLTGYQSERLLTPAEAGWLHIVLLWQALAMVPPGDDPTGWGPSALSQLSQETAR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BEZ_A_2(6EF6)
?
[Raw transfer]




EDO_A_14(3CSV)
?
[Raw transfer]




MES_B_6(3I1A)
?
[Raw transfer]




UNL_A_2(3F7W)
?
[Raw transfer]




ACY_A_10(4WH3)
NAHK_BIFL2
[Raw transfer]




17 Fugue 80.8519% -44 - C6 -2PPQ - KHSE_AGRFC -
34 HHSearch 73.0818% -58 - C6 -2PPQ - KHSE_AGRFC -
32 HHSearch 71.6818% -27 - C6 -6EF6 2.7 ?
33 HHSearch 70.2916% -27 - C6 -4PDY - ? -
22 Fugue 68.7814% -9 - C6 -3I1A - ? -
21 Fugue 67.4614% -20 - C6 -1ZYL - SRKA_ECOLI -
18 Fugue 66.7614% 2 - C6 -2QG7 - ? -
23 Fugue 63.2211% -19 - C6 -3HAM - ? -
35 HHSearch 63.0015% -63 - C6 -2Q83 - COTI_BACSU -
56 SP3 62.0813% -41 - C6 -1NW1 - CKA2_CAEEL -
38 HHSearch 61.9615% -27 - C6 -4WH3 3.1 NAHK_BIFL2
36 HHSearch 61.4617% -35 - C6 -1ZYL - SRKA_ECOLI -
37 HHSearch 61.0414% -20 - C6 -4OCV - ? -
1 PsiBlast_PDB 61.0423% -55 - C8 -2PPQ - KHSE_AGRFC -
25 Fugue 56.7120% 23 - C2 -4P0G - MLTF_PSEAE -
39 HHSearch 56.5117% -3 - C6 -3I1A 1.3 ?
26 Fugue 56.5122% 9 * C7 *5L7J - ? -
20 Fugue 53.4412% -36 - C6 -1NW1 - CKA2_CAEEL -
53 HHSearch 50.6317% -29 - C6 -3F7W 2.9 ?
54 SP3 49.9012% -35 - C6 -1ND4 - KKA2_KLEPN -
46 HHSearch 41.1515% -11 - C6 -3CSV 2.8 ?