@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A9KJ63_LACP7: (2019-01-26 )
MEDKKMLHILNNLYNINFKTMEFLREGGCISYRLSSENSSYFMKIISSAFMDTAKQSLSIISYLTQKGFPSPRIIHTKEGLPYVEIEELNKKTLIVLFEFIEGSEPNEGEDIETIGKLVGQLHNILKGYKEPLPVHGKEFFIDRYIKILEQKNYDQNKIDTFREYGDVLWENVKNLPHGFCHGDLHRGNLLKTTTKKYYLLDFDTSSYAFPMYDIMVMCNSTDYFNFNEIGYQKSKNTYETFLKGYTKYRSLSKDELNSFYDFIAIYHYQLQATIIEIYGLNCVDIEFLDNQLNWLMKWREQCKAR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_A_3(4R78)
?
[Raw transfer]




ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




HIS_A_2(4PDY)
?
[Raw transfer]




MES_A_3(3I1A)
?
[Raw transfer]




MES_B_6(3I1A)
?
[Raw transfer]




121 HHSearch 71.7620% -27 - C1 -2Q83 4.3 COTI_BACSU
105 Fugue 67.3118% 18 - C1 -3I1A 2.0 ?
120 HHSearch 66.4617% 26 - C1 -6EF6 3.6 ?
111 Fugue 63.9816% 17 - C1 -4OCV - ? -
2 PsiBlast_PDB 62.7722% -78 - C1 -3I0Q - ? -
102 Fugue 59.2714% 12 - C1 -2PPQ - KHSE_AGRFC -
119 HHSearch 58.8719% -10 - C1 -2PPQ - KHSE_AGRFC -
1 PsiBlast_PDB 57.4422% -0 - C1 -3I0O - ? -
123 HHSearch 57.2015% 14 - C1 -4OCV - ? -
125 HHSearch 57.1821% 4 - C1 -3I1A 2.8 ?
94 SP3 56.9912% -22 - C1 -1NW1 - CKA2_CAEEL -
5 PsiBlast_PDB 56.7424% 28 - C1 -2Q83 - COTI_BACSU -
4 PsiBlast_PDB 56.6722% -9 * C1 *3Q2M - ? -
122 HHSearch 55.8816% 2 - C1 -1ZYL - SRKA_ECOLI -
3 PsiBlast_PDB 55.4422% 2 - C1 -3I1A - ? -
124 HHSearch 55.2214% 6 - C1 -4WH3 - NAHK_BIFL2 -
104 Fugue 53.7114% 30 - C1 -1ZYL - SRKA_ECOLI -
118 HHSearch 52.3015% 5 - C1 -4PDY 3.0 ?
93 SP3 51.2213% 4 - C1 -1J7L - KKA3_ENTFL -
113 Fugue 50.0014% 18 - C1 -1NW1 - CKA2_CAEEL -
131 HHSearch 44.0919% 7 - C1 -4R78 6.1 ?