@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A9KMG0_LACP7: (2019-01-26 )
MLKMRNLISNYELAKDLLKNWEYDEENLDEMLSYFRISSNAIYPFFYKKKICFLRIAPTDEKRKENIYGEIEFIQYLREHDFKALCPVPSKNGEFIRIVNTKWGEYYATVFEKVAGKPVEACEYSEKMYHEYGKTMGRMHRLSSGFKPIIKKWTHEDVLNEIETMLTLYHCSNKAKIELENLRVELAKLPKNHLSYGLIHYDFELDNVFYDEKTNTCSVIDFDDGMYHWYSTDIEQFLDSVSEEKGELEAEQVKIAFFEGYQSEYPIVEETKNSIPLMRRFINLYSYVRIHHCLSDSFTSEKEWMTELRVKLTNMLKSIEETW

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_2(3F7W)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




46 HHSearch 85.3020% -5 - C3 -6EF6 3.0 ?
1 PsiBlast_PDB 82.6822% -15 - C3 -6EF6 - ? -
49 HHSearch 79.9717% -65 - C3 -2Q83 - COTI_BACSU -
47 HHSearch 76.3220% 8 * C3 *2PPQ - KHSE_AGRFC -
30 Fugue 70.7917% 21 - C3 -2Q83 - COTI_BACSU -
32 Fugue 68.7612% -21 - C3 -1ZYL - SRKA_ECOLI -
45 Fugue 68.4514% 5 - C3 -3CSV - ? -
50 HHSearch 67.2716% -5 - C3 -1ZYL - SRKA_ECOLI -
48 HHSearch 67.2713% -19 - C3 -4PDY - ? -
53 HHSearch 63.4213% 7 - C3 -4WH3 - NAHK_BIFL2 -
2 PsiBlast_PDB 62.8027% -5 - C4 -2PPQ - KHSE_AGRFC -
51 HHSearch 62.1814% 19 - C3 -4OCV - ? -
33 Fugue 60.6211% -30 - C3 -3I1A - ? -
39 Fugue 60.2614% 38 - C3 -4OCV - ? -
52 HHSearch 56.4213% -1 - C3 -3I1A - ? -
63 HHSearch 55.6616% 3 - C3 -3C5I - ? -
71 SP3 53.6012% 18 - C3 -1NW1 - CKA2_CAEEL -
58 HHSearch 53.1414% 6 - C3 -3CSV - ? -
42 Fugue 51.4211% -24 - C3 -3JR1 - ? -
62 HHSearch 51.1312% -3 - C3 -5IGI - ? -
68 HHSearch 50.0915% -7 - C3 -3F7W 3.1 ?