@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A9NGK0_ACHLI: (2019-01-26 )
MLIEDKIVEIATRVFQVNEIDVRVDSRFKGGMSNYTYLVYVKEQPYVIRIIGDGGEVLVKPSIEKKHIQQAKALNLNSELVYFDSKTGVKVSKYVEGTPLSVSMEETDYPLVANALKTLHQAKLPGEDYGLKERLRRYEKLLKKEPSTTYYTLKMQWLKLYDAYFSKLPKVLCHGDAQRSNLVKSGDKIYLLDWEFSGLNDPYYDIASFGNIDFKDAEKLLGYYLERTPSAFELAHIRFYRMYQVLQWHIVATYKHEINLSEKLHLDFEMIAGKYLSLAGHFLEQLKEIEQFK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(3MES)
?
[Raw transfer]




ADP_B_9(3MES)
?
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




EDO_A_10(5FTG)
CHKA_HUMAN
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




32 HHSearch 85.2825% 13 - C2 -4R7B - ? -
31 HHSearch 85.0525% 19 * C2 *4R78 4.0 ?
37 HHSearch 75.9221% -14 - C2 -3DXQ - ? -
38 HHSearch 75.0321% -10 - C- -3DXQ - ? -
54 Fugue 73.0419% 8 - C2 -1NW1 - CKA2_CAEEL -
33 HHSearch 73.0320% -19 - C2 -1NW1 - CKA2_CAEEL -
2 PsiBlast_PDB 72.6230% 25 - C2 -4R78 3.8 ?
69 SP3 72.4618% -8 - C2 -1NW1 - CKA2_CAEEL -
3 PsiBlast_PDB 71.9830% 23 - C2 -4R7B - ? -
34 HHSearch 71.9620% -14 - C2 -1NW1 - CKA2_CAEEL -
35 HHSearch 71.4122% 16 - C2 -2QG7 - ? -
1 PsiBlast_PDB 70.7430% 24 - C2 -4R77 - ? -
55 Fugue 70.3220% 17 - C2 -2QG7 - ? -
36 HHSearch 68.1222% 17 - C2 -2QG7 - ? -
39 HHSearch 66.2619% 14 - C2 -3C5I - ? -
4 PsiBlast_PDB 66.0123% -1 - C- -3DXQ - ? -
45 HHSearch 63.7216% -12 - C2 -5FUT - CHKA_HUMAN -
44 HHSearch 63.5616% -26 - C2 -5FTG 3.2 CHKA_HUMAN
56 Fugue 63.4916% -19 - C2 -3ATS - Y3168_MYCTU -
41 HHSearch 62.6216% -25 - C2 -3MES 6.0 ?
42 HHSearch 58.9016% -25 - C2 -3MES 6.2 ?
47 HHSearch 54.4715% 1 - C2 -6EF6 3.0 ?