@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B2TNJ0_CLOBB: (2019-01-26 )
MFKDIENRFGAKIQDIKVLKSGWAGEIISLEFKDNTQKYVIKTYNSSKNGLENIKQEWTGLNLLYNANYPVPRPIISDFVNEKPYIVMEKIEGENLWTCYQTLSKEDRQQLLEKFVKVFLKLHELDVSIIDKELRKDSTSSFIEKEINEIKKLVEENKLEYFTQIIDWLQKEKANIIGEKLSIIHRDYHPWNVIVDNNKAIYVIDLLWGIGDYRFDLAWMYTLMERSGFEDFSQNALKKYKELKNQNINNFEYFKVFSTLRWLINVMISLKTGENLNETRNKEFENFVSPLIQNRIMSIKKITGIQITI

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_7(1J7L)
KKA3_ENTFL
[Raw transfer]




ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




ADP_A_2(4DCA)
?
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




MES_A_3(3I1A)
?
[Raw transfer]




UNL_A_3(3JR1)
?
[Raw transfer]




41 Fugue 78.5016% 13 - C2 -3ATS - Y3168_MYCTU -
57 HHSearch 78.1118% 22 - C2 -3ATT 3.4 Y3168_MYCTU
56 HHSearch 77.4118% 25 * C2 *3ATS - Y3168_MYCTU -
63 HHSearch 71.1818% -36 - C2 -3DXP - ? -
75 HHSearch 69.8419% 9 - C2 -4DCA 4.9 ?
43 Fugue 67.3415% 31 - C2 -3HAM - ? -
6 PsiBlast_PDB 66.5524% -2 - C2 -5BYL - AACA_STAAU -
49 Fugue 66.3419% 51 - C2 -3JR1 2.6 ?
10 PsiBlast_PDB 65.8524% 2 - C2 -5IQD - AACA_STAAU -
18 PsiBlast_PDB 65.6724% 2 - C2 -6CGG - AACA_STAAU -
11 PsiBlast_PDB 65.4224% 4 - C2 -5IQE - AACA_STAAU -
12 PsiBlast_PDB 64.9524% -1 - C2 -5IQF - AACA_STAAU -
1 PsiBlast_PDB 64.9324% -8 - C2 -5IQI - AACA_STAAU -
16 PsiBlast_PDB 64.4824% -1 - C2 -6CEY - AACA_STAAU -
7 PsiBlast_PDB 64.4524% -6 - C2 -5IQA - AACA_STAAU -
17 PsiBlast_PDB 64.4124% -2 - C2 -6CGD - AACA_STAAU -
13 PsiBlast_PDB 64.1624% -5 - C2 -5IQG - AACA_STAAU -
15 PsiBlast_PDB 64.1024% -4 - C2 -6CAV - AACA_STAAU -
9 PsiBlast_PDB 63.7824% -3 - C2 -5IQC - AACA_STAAU -
2 PsiBlast_PDB 63.5724% -3 - C2 -6CH4 - AACA_STAAU -
59 HHSearch 62.0720% -11 - C2 -4R78 4.1 ?
42 Fugue 56.2916% 36 - C2 -1J7L 4.8 KKA3_ENTFL
44 Fugue 55.7315% 46 - C2 -3I1A 2.2 ?
72 HHSearch 48.7216% 21 - C2 -2Q83 3.7 COTI_BACSU