@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B2UM73_AKKM8: (2019-01-26 )
MKELSRLVHRSFHIIPRQEDFRPLALGASGRTIVRIHFGGRTCIGIQWGNDRADNDSFIPAARHLHAHGVNVPEIYDYEPLGPGCGAALVEDLGDANLLAFRKEPWPSLRLRYIRAMEQLHLLHSCPFPEEFPLQPAFDEALYRWEQSYFAEHFLGSHLGLETASFLNHPALKEQAQFLAALPECPVHRDSQSQNVHIHAGKTWLIDFQGMRGGRPEYDLASLVYDGYARLEPEQADELLREWENISAHSIDHRIFRACALQRIMQMLGAYANIGHNQGKTWYLAQIPAGLGHLRKLLPGSTLAEPLAAMLA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_A_3(4R78)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




22 Fugue 80.5123% -6 - C7 -3CSV 3.2 ?
47 HHSearch 76.1823% 7 - C7 -3CSV 3.3 ?
26 Fugue 61.5413% 24 - C7 -3I1A - ? -
39 SP3 57.1813% -8 - C7 -1NW1 - CKA2_CAEEL -
34 Fugue 57.0614% -4 - C7 -1NW1 - CKA2_CAEEL -
28 Fugue 54.9314% 18 - C7 -2PPQ - KHSE_AGRFC -
23 Fugue 52.6414% 11 - C7 -1ZYL - SRKA_ECOLI -
50 HHSearch 52.4618% -22 - C7 -3DXQ - ? -
29 Fugue 51.9712% -8 - C7 -3HAM - ? -
27 Fugue 51.3612% 7 - C7 -2OLC - MTNK_BACSU -
30 Fugue 51.0613% -9 - C7 -3ATS - Y3168_MYCTU -
49 HHSearch 50.1218% -19 - C- -3DXQ - ? -
59 HHSearch 48.4917% -31 - C7 -2PPQ - KHSE_AGRFC -
37 SP3 47.1311% -19 - C7 -1ND4 - KKA2_KLEPN -
55 HHSearch 46.4512% -22 - C7 -5FTG - CHKA_HUMAN -
56 HHSearch 46.1212% -13 - C7 -5FUT - CHKA_HUMAN -
52 HHSearch 45.0713% -16 - C7 -1ZYL - SRKA_ECOLI -
60 HHSearch 41.9612% -22 - C7 -4OCV - ? -
54 HHSearch 41.3814% -31 - C7 -5IGH - ? -
57 HHSearch 40.6915% 30 - C7 -4R78 4.4 ?