@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B2W7V1_PYRTR: (2019-01-26 )
MSTTPDLPKERVITQEEFDNAVKLGGKFAPVFKVDEKTVVKTSDMTQLGEAAAMKMVREKTTIPVPEDQNVYTDPTTGDVPIVMDFIEGDCLLDVWDTYDNDQKQQIIEQLHSYFAQLRELKGSFIGSVDGKFCFDQVFDQDIGGHGPYEDEASFNEGLVKALKNTMISGWGDTVCDMVLAMKDHEIVFTHGDISPRNILVKDCNIVSVLDWEYSGYYPEYWEYAKAFFRPAWEKSWIKDRAVNKILKPYPLENAICQHVFSFGAW

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_2(3TM0)
KKA3_ENTFL
[Raw transfer]




KAN_A_9(1ND4)
KKA2_KLEPN
[Raw transfer]




ADP_A_4(1L8T)
KKA3_ENTFL
[Raw transfer]




ADP_A_7(1J7L)
KKA3_ENTFL
[Raw transfer]




ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




28 Fugue 77.9415% 32 - C4 -1J7L 4.8 KKA3_ENTFL
1 PsiBlast_PDB 72.2426% -34 - C4 -3ATS - Y3168_MYCTU -
2 PsiBlast_PDB 72.0226% -40 - C4 -3ATT - Y3168_MYCTU -
71 HHSearch 68.8320% 8 - C4 -3ATS - Y3168_MYCTU -
72 HHSearch 68.5620% 14 - C4 -3ATT 3.7 Y3168_MYCTU
58 HHSearch 66.6916% 34 - C4 -5IQC - AACA_STAAU -
32 Fugue 66.2916% 14 - C4 -3ATS - Y3168_MYCTU -
57 HHSearch 66.2116% 32 * C4 *5IQI - AACA_STAAU -
43 SP3 65.5314% 39 - C4 -1J7L - KKA3_ENTFL -
62 HHSearch 62.5916% 27 - C4 -4GKI - ? -
61 HHSearch 61.0916% 34 - C4 -4GKH - ? -
44 SP3 60.7414% 14 - C4 -1ND4 - KKA2_KLEPN -
56 HHSearch 60.3716% 2 - C4 -5UXD - ? -
63 HHSearch 59.8718% 26 - C4 -1ND4 4.6 KKA2_KLEPN
53 HHSearch 59.4316% 36 - C- -3N4U - ? -
42 Fugue 59.0313% 32 - C4 -3JR1 - ? -
60 HHSearch 58.8618% 50 - C4 -1L8T 4.2 KKA3_ENTFL
64 HHSearch 57.6714% 22 - C4 -4DCA - ? -
59 HHSearch 56.4118% 52 - C4 -3TM0 5.9 KKA3_ENTFL
67 HHSearch 56.1712% 25 - C4 -5IGI - ? -