@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B4D7J5_9BACT: (2019-01-26 )
MLAGCDRCRASSPPDPVNESAEFLQLLRQDGVVRTDDARLMPLTGGVSCEIYLVEDGAERFVVKRALAKLKVKADWFADICRNRYEWEFIRYVSRFLPAVVPALRHCSATGNYFAMEYLGGEFQNWKQQLLAGEARPEAAAQAGGLLAEIHRHSTGDAEAKRIFDTTPNFYQLRIEAYLLATGVKHPELRPLFEAEAARLAATRECLVHGDFSPKNILVSPERMVLLDCEVAWYGDPSFDLAFMLNHFFLKTLLHAPREVGMRRMVEAFWAAYQTGRPTPELETRVGRLLVMLLLARVDGKSPVEYLDVGRQDFVRQFARVMLHEEAPSLGVVTNAWFARLSQFTS

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_11(2PYW)
MTK_ARATH
[Raw transfer]




ADP_A_6(2OLC)
MTNK_BACSU
[Raw transfer]




ADP_A_6(2OLC)
MTNK_BACSU
[Raw transfer]




ACP_A_6(2PUL)
MTNK_BACSU
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




GOL_A_2(5IWU)
?
[Raw transfer]




ZIT_A_3(5IGI)
?
[Raw transfer]




UNL_A_3(3JR1)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




34 HHSearch 78.7217% -64 - C1 -2PUL 6.0 MTNK_BACSU
33 HHSearch 77.9219% -25 - C1 -2PYW 4.5 MTK_ARATH
78 Fugue 76.1717% -25 - C1 -4OCV - ? -
64 Fugue 75.8417% -59 - C1 -2OLC 5.5 MTNK_BACSU
35 HHSearch 73.5417% -63 - C1 -2OLC 5.5 MTNK_BACSU
73 Fugue 65.4317% -8 - C1 -3ATS - Y3168_MYCTU -
3 PsiBlast_PDB 63.2120% -18 - C1 -2PYW - MTK_ARATH -
69 Fugue 59.5218% -13 - C1 -3CSV 2.1 ?
1 PsiBlast_PDB 57.5523% -29 - C1 -2PUL - MTNK_BACSU -
2 PsiBlast_PDB 57.0723% -33 - C1 -2PUN - MTNK_BACSU -
38 HHSearch 55.5622% -52 - C1 -5UXD - ? -
67 Fugue 55.5016% -48 - C1 -2PPQ - KHSE_AGRFC -
43 HHSearch 55.4518% -34 - C1 -6EF6 3.2 ?
39 HHSearch 54.8516% -48 - C1 -3DXQ - ? -
48 HHSearch 52.8013% -58 * C1 *3TDW - ? -
71 Fugue 52.4813% -24 - C1 -3HAM - ? -
66 Fugue 51.5615% -16 - C1 -3JR1 2.5 ?
65 Fugue 51.3315% -41 - C1 -1J7L - KKA3_ENTFL -
46 HHSearch 50.8719% -46 - C1 -1ZYL - SRKA_ECOLI -
40 HHSearch 50.1716% -47 - C- -3DXQ - ? -
36 HHSearch 48.1917% -27 - C1 -3CSV 2.8 ?
42 HHSearch 47.4117% -53 - C1 -5IGI 4.3 ?
44 HHSearch 45.3215% -25 - C1 -5IWU 3.0 ?
50 HHSearch 37.6317% 31 - C1 -4R78 4.5 ?