@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B4D9C8_9BACT: (2019-01-26 )
MEEDRRHPRRQLDPALIASYLAGRKIELVQLMPLGKSNTNYRLTLADGEVCLLRLHHPGANAERENHILRLVREIVPVPAVLASGSDWSIHSFVEGIPLADAPESVHAAAEALARIASLRFTSSGWIQADGSIAPFDFGDGKSFVESMLERADVRAWVGADTAAALRRIEAAQPPAADDEPRLVHGDFNPTNILVHQRAVTGILDWEFSHAGSPYMDIGNLLRHTDPAQHGALEAGLVAGGLNVPADWRQQAEMVDLSSHLEFLTTQRSDAFKQRCADWIRDFVERY

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_2(3TDW)
?
[Raw transfer]




ADP_A_7(1J7L)
KKA3_ENTFL
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




ZIT_A_3(5IGI)
?
[Raw transfer]




51G_A_6(5IQC)
AACA_STAAU
[Raw transfer]




EDO_A_10(5FTG)
CHKA_HUMAN
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




PQ7_A_11(5FUT)
CHKA_HUMAN
[Raw transfer]




2 PsiBlast_PDB 75.6922% -23 - C4 -3W0N - KHYB_ECOLX -
3 PsiBlast_PDB 75.5022% -25 - C4 -3W0O - KHYB_ECOLX -
31 Fugue 75.2115% -39 - C4 -2PPQ - KHSE_AGRFC -
4 PsiBlast_PDB 74.9222% -29 - C4 -3W0R - KHYB_ECOLX -
25 Fugue 74.7620% -4 - C4 -3ATS - Y3168_MYCTU -
30 Fugue 74.6517% -2 - C4 -1ZYL - SRKA_ECOLI -
5 PsiBlast_PDB 74.2422% -24 - C4 -3W0P - KHYB_ECOLX -
9 PsiBlast_PDB 74.1921% -40 - C4 -3W0S - KHYB_ECOLX -
1 PsiBlast_PDB 73.7322% -23 - C4 -3W0M - KHYB_ECOLX -
6 PsiBlast_PDB 73.2422% -22 - C4 -3W0Q - KHYB_ECOLX -
23 Fugue 72.8417% -7 - C4 -1J7L 4.3 KKA3_ENTFL
48 HHSearch 72.6116% -45 - C4 -3TDW 4.3 ?
62 SP3 70.4414% 0 - C4 -1J7L - KKA3_ENTFL -
56 HHSearch 69.6816% -21 - C4 -5IQI - AACA_STAAU -
55 HHSearch 69.6415% -34 - C4 -5IQC 2.1 AACA_STAAU
27 Fugue 69.5214% -5 - C4 -3HAM - ? -
53 HHSearch 68.3217% -16 - C4 -5FUT 2.2 CHKA_HUMAN
52 HHSearch 67.7115% -28 - C4 -4DCA - ? -
36 Fugue 67.2213% 18 * C4 *2QG7 - ? -
47 HHSearch 65.3615% -32 - C4 -2PPQ - KHSE_AGRFC -
54 HHSearch 63.6017% 5 - C4 -5FTG 3.0 CHKA_HUMAN
50 HHSearch 62.3416% 8 - C4 -4R78 3.9 ?
59 HHSearch 58.2716% -25 - C4 -6EF6 2.5 ?
41 HHSearch 55.3018% -18 - C4 -5IGI 3.8 ?