@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B4WZ99_9GAMM: (2019-01-26 )
MSQVDTLDTQKLAEYLEQHIDGFKGPIEADKFEGGQSNPTFKITAASGAYVLRRQPPGKLLKSAHAVDREFRVMAALKDTDVPVPNVLHLCEDRDVIGSMFYVMEFCEGRILWSAGLPEMGEGEAANAVRGEMYSEMNRVLAAMHSVDLEAVGLTDYGKPGNYFERQLGRWTQQYEASKLQEIPAMDSLIEWLQANQPEDDGQVSLVHGDYRLDNMMWHPEKPQVIAVLDWELSTLGHPLADLAYQCMGMRMPQRGAKMAGLQGKDRTALGIPTEKEYVAMYCERRGISQIDNWEFYLAFSFFRLAAICQGVAKRAEDGNASNKQAAEVGALVEPLATMAMQIINEGA

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_7(1J7L)
KKA3_ENTFL
[Raw transfer]




ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




36 HHSearch 93.3852% -94 - C3 -3DXP - ? -
1 PsiBlast_PDB 82.8950% -22 - C3 -3DXP - ? -
22 Fugue 68.1246% 14 - C3 -3DXP - ? -
38 HHSearch 55.9024% -26 - C3 -3ATS - Y3168_MYCTU -
21 Fugue 55.7122% -8 * C3 *3ATS - Y3168_MYCTU -
37 HHSearch 55.6724% -22 - C3 -3ATT 4.0 Y3168_MYCTU
2 PsiBlast_PDB 50.8425% -31 - C3 -3ATS - Y3168_MYCTU -
3 PsiBlast_PDB 50.5825% -30 - C3 -3ATT 4.0 Y3168_MYCTU
59 SP3 45.3913% 19 - C3 -1NW1 - CKA2_CAEEL -
25 Fugue 44.4817% -36 - C3 -1J7L 4.8 KKA3_ENTFL
45 HHSearch 44.2818% -22 - C3 -6EF6 3.6 ?
42 HHSearch 42.5119% -44 - C3 -5IGI - ? -
43 HHSearch 42.2217% -72 - C3 -2PPQ - KHSE_AGRFC -
28 Fugue 42.1812% -17 - C3 -2PPQ - KHSE_AGRFC -
48 HHSearch 41.9514% -22 - C3 -1NW1 - CKA2_CAEEL -
49 HHSearch 41.6214% -20 - C3 -1NW1 - CKA2_CAEEL -
47 HHSearch 41.2015% -19 - C3 -5IQI - AACA_STAAU -
34 Fugue 40.7813% 2 - C3 -3JR1 - ? -
55 HHSearch 40.0215% -16 - C3 -5IQC - AACA_STAAU -
51 HHSearch 39.9116% -36 - C3 -4R7B - ? -
50 HHSearch 39.6616% -31 - C3 -4R78 4.1 ?