@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B5HLT6_9ACTN: (2019-01-26 )
MCINFLVCASLSMFRTSVSGARVPIGAWPDRGGEVRDAVLSVFRRNEYMREIDTGARVASPGTGCDGLVGTCPVDKPVDSVAVGVLARFLAQLTLVRKEALPALPAEWSRNERDSRAYLDTLVRHAKRRMLDPNWTAIGGLFAVLGVPGDRLVRFAEQVPAMSRRPYGLLLTNLARDNVTILEGPKLAEAGLDWTSASYGDPLHGLAGHVVRMRYPQDQVNEVVQAWACEMRRIRPPAVSGLDRDLPYYLDFERIHAAYDDVIRAARSLGDSIENLALLAAASDIGTALKRAAGLLGMSEVPPEKEIADALFRWQAARLVRAAERVPDSLFRWRCDDRVPERDDFPSDLVRRALAVEGVAPADRVFRGTAHLNTVVQLENYPDPVVVRRETAAAPRREQGLLPEHAVLQVIERSGVQVRAPRILALGYDDRRRHVAIHTYEGPGGRSPQHPVDGLLPAEADELVDELAALAEVDHSSLPSNEPEGGFYRWLAERLADFVAALPDATLRAADQRGLPDGDLLRQILGRYKVSDRAPVLLHGDLNPWNLVRAGRQGGLTIIDWEMGMIGDPLYDLVRHLHLTPTRTEMRVRMFDRWSKKLPAECVVGWEEDWRVYRYIEQIRSAYVDLDRMTTGAALSTPNVRRAVDAYEMTLSAATGSLGLRRRVVPKVPASLKVS

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_8(3ATT)
Y3168_MYCTU
[Raw transfer]




LLL_A_3(3HAM)
?
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




62 Fugue 67.6319% 34 - C5 -4PQG - ? -
53 Fugue 67.3416% -77 * C9 *5UFL - CIP2A_HUMAN -
51 Fugue 58.0614% -65 - C10 -1ZYL - SRKA_ECOLI -
59 Fugue 53.4617% 10 - C8 -4R8A - FAN1_PSEAE -
57 Fugue 52.5016% -20 - C9 -4L9M - GRP1_HUMAN -
32 HHSearch 51.5614% -91 - C10 -3DXQ - ? -
56 Fugue 51.5316% -19 * C8 *5E75 - SUSD_BACO1 -
30 HHSearch 50.2517% -9 - C10 -3DXP - ? -
27 HHSearch 48.4813% -25 - C10 -4R78 - ? -
47 Fugue 47.6715% -18 - C10 -3HAM 2.0 ?
26 HHSearch 47.3813% -25 - C10 -4R7B - ? -
41 HHSearch 47.3616% 16 - C10 -3ATT 4.2 Y3168_MYCTU
66 SP3 47.2411% 4 - C5 -1LLW - GLTS_SYNY3 -
70 SP3 46.4710% 23 - C2 -1KBL - PPDK_CLOSY -
48 Fugue 46.3213% -40 - C10 -1J7L - KKA3_ENTFL -
42 HHSearch 46.1616% 16 - C10 -3ATS - Y3168_MYCTU -
33 HHSearch 45.7614% -87 - C- -3DXQ - ? -
71 SP3 45.4912% 16 - C5 -1KWG - BGAL_THETH -
39 HHSearch 45.4912% -20 - C10 -1NW1 - CKA2_CAEEL -
65 SP3 43.925% 10 - C10 -1NW1 - CKA2_CAEEL -
44 HHSearch 37.3217% 8 - C10 -6EF6 3.3 ?