@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B5X3C6_SALSA: (2019-01-26 )
MMLMKKMRTAARLRSQLWSLKMPSLCHRSFAAISTYKAVIFDMYGVLIPSPVKLATVFEQQNSVPLGTLGRAIRTGGELNAWKRFMRGEIGAEEFVEAFGRQCSEIAGCPVPIGSFLSDLTSGPMTRPLPVMMKAILCARSRGLKTAVLSNNFFQLNGDPFLPLDHSLFDVIVESCREGLSKPDPRIYHLCLNRLGVSAHEAVFLDDLELNVKAAVQLGMHAIKVGDLAVSVKELEGMLGIPLSGFVPGPDSAPWATKLPMDRLTQYLRKALHLSDEDPVAVQQLSPSQSNSLYHLTTGGRHLLLRKQQKTSRAMETEYRMLKSLNGSSIPVPEIIDLCEDPSVLGAPFLLMEVCLGRMFSDHSLPGLTPGDRRALYQAMQHTLCQIHCLDTRVVGLEDYDEPVDYMGLQVRWWTQQYRDSETPPIPAMERLIQWLPLHLPKHQRTTLIHGSFRLENLVFHAEKPEVVAVMDWGRSRLGDPLIDLTFSCMGHCLPQDNPLLTGISDRGLVQLGIPTVEEVMGQYCSSMGLEEGIPDWNFYMAFHLFCLAASHQGESKSTIAGTRT

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_A_7(5AKI)
HYES_HUMAN
[Raw transfer]




GOL_A_5(5ALJ)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5AIA)
HYES_HUMAN
[Raw transfer]




GOL_A_4(5AI9)
HYES_HUMAN
[Raw transfer]




DMS_A_3(5AI4)
HYES_HUMAN
[Raw transfer]




DMS_A_6(5ALN)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5ALD)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5ALW)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5ALO)
HYES_HUMAN
[Raw transfer]




DMS_A_3(5ALT)
HYES_HUMAN
[Raw transfer]




GOL_A_7(5ALE)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5AKX)
HYES_HUMAN
[Raw transfer]




PEG_A_2(5AI0)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5AK3)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5AKH)
HYES_HUMAN
[Raw transfer]




DMS_A_5(5ALL)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5ALH)
HYES_HUMAN
[Raw transfer]




DMS_A_3(5ALU)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5ALM)
HYES_HUMAN
[Raw transfer]




DMS_A_5(5AM1)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5AKE)
HYES_HUMAN
[Raw transfer]




DMS_A_5(5AKJ)
HYES_HUMAN
[Raw transfer]




GOL_A_6(5AK6)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5AK5)
HYES_HUMAN
[Raw transfer]




DMS_A_3(5AKG)
HYES_HUMAN
[Raw transfer]




DMS_A_7(5AM4)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5AM0)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5AM2)
HYES_HUMAN
[Raw transfer]




DMS_A_3(5AKY)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5AK4)
HYES_HUMAN
[Raw transfer]




DMS_A_3(5AI6)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5ALK)
HYES_HUMAN
[Raw transfer]




DMS_A_4(5ALY)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5AM5)
HYES_HUMAN
[Raw transfer]




DMS_A_2(5AI5)
HYES_HUMAN
[Raw transfer]




204 HHSearch 90.1237%-109 - C3 -3DXP - ? -
1 PsiBlast_PDB 85.1436% -93 - C3 -3DXP - ? -
57 Blastp_CBE 65.9635% -32 - C2 -5ALO 3.1 HYES_HUMAN
68 Blastp_CBE 65.8535% -31 - C2 -5ALD 3.2 HYES_HUMAN
47 Blastp_CBE 65.8335% -36 - C2 -5ALY 3.3 HYES_HUMAN
76 Blastp_CBE 65.7135% -28 - C2 -5AKH 3.1 HYES_HUMAN
15 PsiBlast_PDB 65.6235% -36 - C2 -4OD0 - HYES_HUMAN -
44 Blastp_CBE 65.5735% -33 - C2 -5AM1 3.4 HYES_HUMAN
89 Blastp_CBE 65.5635% -33 - C2 -5AI5 3.3 HYES_HUMAN
88 Blastp_CBE 65.4835% -30 - C2 -5AI6 3.1 HYES_HUMAN
85 Blastp_CBE 65.4335% -31 - C2 -5AIA 3.3 HYES_HUMAN
13 PsiBlast_PDB 65.4235% -35 - C2 -4J03 - HYES_HUMAN -
80 Blastp_CBE 65.3635% -33 - C2 -5AK5 3.1 HYES_HUMAN
63 Blastp_CBE 65.3535% -31 - C2 -5ALI - HYES_HUMAN -
16 PsiBlast_PDB 65.2335% -34 - C2 -6AUM - HYES_HUMAN -
58 Blastp_CBE 65.2235% -31 - C2 -5ALN 3.1 HYES_HUMAN
12 PsiBlast_PDB 65.2135% -35 - C2 -4HAI - HYES_HUMAN -
64 Blastp_CBE 65.1935% -31 - C2 -5ALH 3.1 HYES_HUMAN
4 PsiBlast_PDB 65.1435% -30 - C2 -1ZD2 - HYES_HUMAN -
78 Blastp_CBE 65.1335% -33 - C2 -5AKE 3.4 HYES_HUMAN
90 Blastp_CBE 65.1035% -27 - C2 -5AI4 3.2 HYES_HUMAN
81 Blastp_CBE 65.0435% -29 - C2 -5AK4 3.3 HYES_HUMAN
41 Blastp_CBE 64.9935% -32 - C2 -5AM4 3.3 HYES_HUMAN
67 Blastp_CBE 64.8535% -31 - C2 -5ALE 3.0 HYES_HUMAN
51 Blastp_CBE 64.8235% -32 - C2 -5ALU 3.1 HYES_HUMAN
74 Blastp_CBE 64.8135% -29 - C2 -5AKJ 3.4 HYES_HUMAN
71 Blastp_CBE 64.7235% -23 - C2 -5AKX 3.1 HYES_HUMAN
82 Blastp_CBE 64.7135% -33 - C2 -5AK3 3.2 HYES_HUMAN
49 Blastp_CBE 64.6035% -34 - C2 -5ALW 3.1 HYES_HUMAN
91 Blastp_CBE 64.5535% -29 - C2 -5AI0 2.7 HYES_HUMAN
86 Blastp_CBE 64.4135% -30 - C2 -5AI9 3.0 HYES_HUMAN
70 Blastp_CBE 64.4035% -29 - C2 -5AKY 3.4 HYES_HUMAN
52 Blastp_CBE 64.3935% -33 - C2 -5ALT 3.0 HYES_HUMAN
61 Blastp_CBE 64.3835% -30 - C2 -5ALK 3.4 HYES_HUMAN
75 Blastp_CBE 64.2535% -31 - C2 -5AKI 2.8 HYES_HUMAN
45 Blastp_CBE 64.2435% -31 - C2 -5AM0 3.3 HYES_HUMAN
59 Blastp_CBE 64.2235% -28 - C2 -5ALM 3.4 HYES_HUMAN
40 Blastp_CBE 64.1735% -33 - C2 -5AM5 3.4 HYES_HUMAN
77 Blastp_CBE 63.6535% -27 - C2 -5AKG 3.4 HYES_HUMAN
43 Blastp_CBE 63.6335% -31 - C2 -5AM2 3.2 HYES_HUMAN
60 Blastp_CBE 63.5335% -27 - C2 -5ALL 2.8 HYES_HUMAN
79 Blastp_CBE 63.1735% -32 - C2 -5AK6 2.7 HYES_HUMAN
62 Blastp_CBE 61.2135% -31 - C2 -5ALJ 2.7 HYES_HUMAN