@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B6BH72_SULGG: (2019-01-26 )
MGVKTQLSLHELNQLFPSYGFTEIKPTISGIIDTTYIIHNETTGYILKRYERDITRKIELDIKLLNELKSVGLNVPACLDSNYGWYIYEKLEGKQPTNTKSYHIQALGRFLAKMHSQTSKMRCDSNRIIEDEVTQSLKYVKENFFAYYKRFEFLKNFTHKHEAIIHGDIFKDNTIFNGRKIGVIDFIDSSCGTFAYDVAVTLVGFDARERHDYYINLFLKNYNQHAPKKLSKKVVKEKMKFAANFFALKRVHEYKNTSRAKELLK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_3(4OCV)
?
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




ADP_A_7(1J7L)
KKA3_ENTFL
[Raw transfer]




ZIT_A_3(5IGI)
?
[Raw transfer]




ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




BEZ_A_2(6EF6)
?
[Raw transfer]




MES_A_3(3I1A)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




21 HHSearch 77.8923% 16 - C3 -2PPQ - KHSE_AGRFC -
25 HHSearch 73.0017% 10 - C3 -6EF6 3.8 ?
23 HHSearch 72.1518% 28 - C3 -5IGI 4.3 ?
44 Fugue 69.2217% -9 - C3 -3HAM - ? -
56 Fugue 65.8519% 21 - C3 -4OCV 5.2 ?
45 Fugue 65.3816% 24 - C3 -2Q83 3.6 COTI_BACSU
27 HHSearch 64.9819% 20 - C3 -2Q83 3.6 COTI_BACSU
24 HHSearch 62.3618% -0 - C3 -5IGH - ? -
28 HHSearch 62.2617% 11 - C3 -5UXD - ? -
38 HHSearch 61.6411% -9 - C3 -3DXQ - ? -
59 SP3 61.4617% 4 - C3 -1J7L 2.8 KKA3_ENTFL
49 Fugue 61.1813% 4 - C3 -3ATS - Y3168_MYCTU -
22 HHSearch 60.9015% 22 - C3 -1ZYL - SRKA_ECOLI -
1 PsiBlast_PDB 60.6822% 21 - C3 -2PPQ - KHSE_AGRFC -
41 HHSearch 59.5314% 13 - C3 -4WH3 - NAHK_BIFL2 -
46 Fugue 59.0615% 1 - C3 -1J7L - KKA3_ENTFL -
31 HHSearch 58.5317% 35 - C3 -4R78 3.6 ?
48 Fugue 57.7514% 49 - C3 -2OLC - MTNK_BACSU -
50 Fugue 57.6315% 57 - C3 -3I1A 2.0 ?
30 HHSearch 57.3717% 41 - C3 -4R7B - ? -
26 HHSearch 52.7117% 15 - C3 -3CSV 3.2 ?