@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B7CE77_9FIRM: (2019-01-26 )
MNLEKWIEEKFNTTKYTLEKTDKGISNHNYILTINDTKYMIRVPKKNHESLGLQHEHEKKILTLVSDLDVPTVLFDEKEGIKVTHYIEDVKTFNECKDKDKFARCANLMKSLHTKKAPLFIFNPFGKIEFYKSQIKECIVSFPNEENFLEALKKEYKPNTLCHNDFVQGNILYSDTKDYLIDYEYAAKNDYRFDIASFFSENNIHYIDQRDQFYQTYFDGEIDPMIDVQVQAFERMEDILWGYWANMLYEQRGEQIYFDIAKDKEKHYRG

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(3MES)
?
[Raw transfer]




PT3_A_6(3MES)
?
[Raw transfer]




PT3_B_12(3MES)
?
[Raw transfer]




ADP_B_9(3MES)
?
[Raw transfer]




ADP_A_6(2OLC)
MTNK_BACSU
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




EDO_A_10(5FTG)
CHKA_HUMAN
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




MES_A_3(3I1A)
?
[Raw transfer]




NBR_A_2(5FTG)
CHKA_HUMAN
[Raw transfer]




PQ7_A_11(5FUT)
CHKA_HUMAN
[Raw transfer]




1 PsiBlast_PDB 77.1029% 28 - C1 -4R77 - ? -
3 PsiBlast_PDB 74.9929% 28 - C1 -4R7B - ? -
57 HHSearch 74.6629% 23 - C1 -4R78 4.0 ?
2 PsiBlast_PDB 73.8829% 36 - C1 -4R78 4.3 ?
56 HHSearch 73.7129% 23 - C1 -4R7B - ? -
34 Fugue 72.0522% -1 - C1 -1NW1 - CKA2_CAEEL -
58 HHSearch 70.6821% -2 - C1 -3C5I - ? -
72 SP3 69.9322% 3 - C1 -1NW1 - CKA2_CAEEL -
54 HHSearch 68.5919% 17 - C1 -3DXQ - ? -
61 HHSearch 67.8724% 11 - C1 -5FTG 6.1 CHKA_HUMAN
39 Fugue 67.6616% -3 - C1 -3ATS - Y3168_MYCTU -
65 HHSearch 67.1720% -10 - C1 -3MES 6.1 ?
62 HHSearch 67.0824% 15 - C1 -5FUT 6.4 CHKA_HUMAN
66 HHSearch 64.5720% -17 - C1 -3MES 5.4 ?
51 HHSearch 63.8522% 10 - C1 -1NW1 - CKA2_CAEEL -
55 HHSearch 62.9719% 21 - C- -3DXQ - ? -
50 HHSearch 61.9822% 15 - C1 -1NW1 - CKA2_CAEEL -
52 HHSearch 61.5920% 39 * C1 *2QG7 - ? -
53 HHSearch 59.2320% 47 - C1 -2QG7 - ? -
68 HHSearch 58.5113% -4 - C1 -5IGI - ? -
41 Fugue 50.3815% 50 - C1 -3I1A 3.0 ?
37 Fugue 44.7317% 45 - C1 -2OLC 5.4 MTNK_BACSU