@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B7JCH6_ECOLX: (2019-01-26 )
MACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLLARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KAN_B_10(1ND4)
KKA2_KLEPN
[Raw transfer]




KAN_A_9(1ND4)
KKA2_KLEPN
[Raw transfer]




KAN_A_9(1ND4)
KKA2_KLEPN
[Raw transfer]




KAN_A_9(1ND4)
KKA2_KLEPN
[Raw transfer]




KAN_A_5(1L8T)
KKA3_ENTFL
[Raw transfer]




ATP_A_4(4EJ7)
?
[Raw transfer]




B31_A_3(3TM0)
KKA3_ENTFL
[Raw transfer]




108 HHSearch 90.9731%-123 - C10 -1ND4 4.1 KKA2_KLEPN
5 PsiBlast_PDB 80.5630% -44 - C10 -4FEU - ? -
1 PsiBlast_PDB 79.9835% 10 - C- -4H05 - ? -
7 PsiBlast_PDB 79.7130% -32 - C10 -4GKH - ? -
3 PsiBlast_PDB 79.6130% -45 - C10 -4FEV - ? -
6 PsiBlast_PDB 79.1030% -41 - C10 -4FEW - ? -
104 HHSearch 77.8331% -41 - C10 -4GKI - ? -
4 PsiBlast_PDB 77.6830% -40 - C10 -4FEX - ? -
8 PsiBlast_PDB 77.6130% -30 - C10 -4GKI - ? -
9 PsiBlast_PDB 77.5230% -43 - C10 -4EJ7 3.3 ?
127 SP3 77.4129% 19 - C10 -1ND4 4.4 KKA2_KLEPN
109 HHSearch 77.3732% -10 - C10 -4H05 - ? -
105 HHSearch 76.5131% -38 - C10 -4GKH - ? -
110 HHSearch 73.2632% -3 - C- -4H05 - ? -
21 Blastp_CBE 73.1736% 15 - C10 -1ND4 2.8 KKA2_KLEPN
2 PsiBlast_PDB 70.7335% 16 - C10 -1ND4 4.1 KKA2_KLEPN
107 HHSearch 68.6523% 9 - C10 -1L8T 3.2 KKA3_ENTFL
128 SP3 67.9021% 32 - C10 -1J7L - KKA3_ENTFL -
106 HHSearch 66.2723% 12 - C10 -3TM0 2.3 KKA3_ENTFL
88 Fugue 62.9621% 64 - C10 -1J7L - KKA3_ENTFL -