@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B8CXT6_HALOH: (2019-01-26 )
MSNAEIKDKNYKKLKRNAQNIILKYLGEKREIDGVYNNNWVFLTTDNKKPYMVKFVPQNEARRLEIENTMYKFITSKTDIPVPEVLTYGQNQHGSYLLREVIEGHSLKEYFKKTRNVENIFYEAGQILAKLHSIEFEDKGIIKPDLSVKKYDIFSKTEYLFFLEKLFVNGVISREKYSLLKKVDINYYFGGRKNVLCHCDYTPNNILVKNNQIVGIIDFEWASSAPFMDDLVSFDLFAELDGFNRQINSYYKGYKLIKEIDKFYFENINFYKFYRLITMLSYQVGVTDERYDYQFYNKMRKRFKDIIANCQF

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_7(1J7L)
KKA3_ENTFL
[Raw transfer]




AMP_A_3(4R78)
?
[Raw transfer]




ADN_A_5(2Q83)
COTI_BACSU
[Raw transfer]




GOL_A_5(3HAM)
?
[Raw transfer]




UNL_A_3(3JR1)
?
[Raw transfer]




EDO_A_16(3CSV)
?
[Raw transfer]




HO_A_4(2OLC)
MTNK_BACSU
[Raw transfer]




39 Fugue 77.5518% 13 - C1 -3JR1 2.3 ?
20 PsiBlast_PDB 69.9124% 21 - C1 -3UZR - ? -
46 Fugue 66.5615% -12 - C1 -3CSV 3.0 ?
47 Fugue 66.4615% -16 - C1 -2OLC 2.8 MTNK_BACSU
49 Fugue 65.7515% 30 - C1 -1NW1 - CKA2_CAEEL -
19 PsiBlast_PDB 65.1324% 21 - C1 -3HAV - ? -
45 Fugue 64.7618% 29 - C1 -3HAM 1.7 ?
18 PsiBlast_PDB 64.2524% 19 - C1 -3HAM - ? -
42 Fugue 61.0512% 4 - C1 -1ZYL - SRKA_ECOLI -
54 SP3 59.1415% 24 - C1 -1NW1 - CKA2_CAEEL -
50 Fugue 58.2914% 18 - C1 -2QG7 - ? -
38 Fugue 58.1017% 21 - C1 -1J7L 4.5 KKA3_ENTFL
56 SP3 56.2512% 0 - C- -1F3M - ? -
5 PsiBlast_PDB 54.5425% -21 - C1 -5IQB - AACA_STAAU -
40 Fugue 54.4512% -0 * C1 *3ATS - Y3168_MYCTU -
2 PsiBlast_PDB 54.3025% -28 - C1 -4ORK - AACA_STAAU -
1 PsiBlast_PDB 53.8525% -21 - C1 -5IQH - AACA_STAAU -
6 PsiBlast_PDB 53.8425% -27 - C1 -5IQC - AACA_STAAU -
9 PsiBlast_PDB 53.6125% -20 - C1 -5IQF - AACA_STAAU -
16 PsiBlast_PDB 53.0925% -19 - C1 -6CH4 - AACA_STAAU -
64 HHSearch 50.5521% 41 - C1 -4R78 4.2 ?
68 HHSearch 34.1915% 20 - C1 -2Q83 4.2 COTI_BACSU