@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q0STX8_CLOPS: (2019-02-01 )
MTNKMKNHKITKLGGLNNSNYLLECENNKYVLRIPSKDNKNNFSEENFVLIFANLNKLSPPIIYHNKDNGILISKFLEDSKVNMSTFTSLEFLEKLSINLRKLHILKCEHIFNPFEHIRKNFHILKSKNFNFHQDIDLVLNKLNILEEKLSKNMTIGLCHNDLNSSNVLYYNKNVLFIDFEFSAMCDIFFDLATVSWMLDEKKRYFLIKSYFGYYSYELMEKLENYLFVVKLWNASWSFLKSLNTNSTYDYKLGGNMIIDDLLSTL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PT3_A_6(3MES)
?
[Raw transfer]




30 HHSearch 81.3521% -28 - C2 -3DXQ - ? -
24 HHSearch 77.6721% 7 - C2 -4R78 - ? -
25 HHSearch 77.3821% 7 - C2 -4R7B - ? -
28 HHSearch 76.5720% 3 - C2 -2QG7 - ? -
31 HHSearch 76.2721% 14 - C- -3DXQ - ? -
62 SP3 75.7716% 4 - C2 -1NW1 - CKA2_CAEEL -
4 PsiBlast_PDB 73.4320% -18 - C- -3DXQ - ? -
33 HHSearch 73.1622% -35 - C2 -3C5I - ? -
37 HHSearch 73.0018% -33 - C2 -5FUT - CHKA_HUMAN -
29 HHSearch 72.8620% 20 - C2 -2QG7 - ? -
47 Fugue 69.7816% 25 - C2 -1NW1 - CKA2_CAEEL -
26 HHSearch 68.4415% -37 - C2 -1NW1 - CKA2_CAEEL -
35 HHSearch 68.4219% -22 - C2 -3MES - ? -
36 HHSearch 68.3018% -24 * C2 *5FTG - CHKA_HUMAN -
48 Fugue 68.2019% 24 - C2 -2QG7 - ? -
34 HHSearch 67.0619% -33 - C2 -3MES 3.1 ?
27 HHSearch 66.0615% -38 - C2 -1NW1 - CKA2_CAEEL -
39 HHSearch 64.2216% -2 - C2 -6EF6 - ? -
2 PsiBlast_PDB 63.9626% 3 - C2 -4R78 - ? -
1 PsiBlast_PDB 61.9726% 6 - C2 -4R77 - ? -