@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : R8APF5_PLESH: (2019-02-02 )
MNDAQGSLVHELKSLPCWPAPVQAIRPLTGLSGGSLLIELCDGRRYVARSQNAQLQMQAVSRERERQVLCAIGEQVARSDFLPQVLFYNARWLVVSWLEGSPWPHTLADDACAQRHLVTLMRRFHPVDSELQLDIPSRLQFYRQQLSAEKQPEALFSLCARFASLRSPCWWFPVLAHHDIHPGNVVSDGATLALIDWEYAARSPLACELILLFEANGFNRAQRQQFCRYYAEAIYSTETVYAADSKCVGSSAAALEDWLHRLQQDIASWQPWCEMLMAMWSAIRFEQTDDVQYAVWRDNYLKAAEQSLGKRE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_10(5FTG)
CHKA_HUMAN
[Raw transfer]




50 HHSearch 83.3617% -6 * C2 *3C5I - ? -
27 Fugue 81.2415% 2 - C2 -2QG7 - ? -
43 HHSearch 81.2314% -17 - C2 -2QG7 - ? -
53 HHSearch 80.2113% -21 - C2 -3MES - ? -
31 Fugue 79.0518% -8 - C2 -4OCV - ? -
54 HHSearch 78.4413% -27 - C2 -3MES - ? -
46 HHSearch 77.6217% -22 - C2 -5FTG 3.1 CHKA_HUMAN
47 HHSearch 76.8617% -12 - C2 -5FUT - CHKA_HUMAN -
42 HHSearch 75.6414% -13 - C2 -2QG7 - ? -
49 HHSearch 75.0514% -1 - C2 -3DXQ - ? -
33 Fugue 73.8016% -10 - C2 -3ATS - Y3168_MYCTU -
25 Fugue 72.6714% 2 - C2 -1NW1 - CKA2_CAEEL -
57 HHSearch 72.6217% -25 - C2 -5IWU - ? -
44 HHSearch 72.3616% 8 - C2 -4R78 - ? -
59 HHSearch 72.0018% -38 - C2 -5IGI - ? -
40 HHSearch 71.9315% -6 - C2 -1NW1 - CKA2_CAEEL -
60 HHSearch 71.7818% -38 - C2 -5IGH - ? -
58 HHSearch 71.0917% -19 - C2 -5UXA - ? -
41 HHSearch 70.9415% -7 - C2 -1NW1 - CKA2_CAEEL -
45 HHSearch 69.5416% 4 - C2 -4R7B - ? -