@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : D1BT79_XYLCX: (2019-01-27 )
MRAELDVTVDLARALLVEQHPDLAHLPLAVAANGWDNVMVRAGSDLVLRLPRRAVAAPLLINERAALPLLEPVLSAAVPGVLVPVPVREGAPSEALGYPWPWNVLRWVDGVRAASTPVESRRAWAPTLGRFLAALHRPIADGVPVPRNPFRGVPLAARAVPPFAHLAAHAQHLLPGADAAAHEAALRSTWAQALRAPAYDGPPVWIHGDPHPANLVVAPGAPAPAAAGHGAHDRLVAVVDFGDVTAGDPASDLGSLWLTFDAEGRTACRRAMSDAGAVRDEATWVRARGWAMAFAGTMLAHPDEHPTMVPIGEHALAALLDDR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_A_2(3TDW)
?
[Raw transfer]




LLL_A_3(3HAM)
?
[Raw transfer]




2 PsiBlast_PDB 82.9123% -64 - C2 -3TDV - ? -
1 PsiBlast_PDB 82.6223% -61 - C2 -3TDW - ? -
18 PsiBlast_PDB 78.5619% -65 - C2 -4DFB - ? -
15 PsiBlast_PDB 78.2419% -67 - C2 -3SG8 - ? -
66 HHSearch 78.2218% -39 - C- -3N4U - ? -
7 PsiBlast_PDB 78.1619% -59 - C2 -4DTA - ? -
10 PsiBlast_PDB 78.1319% -67 - C2 -3SG9 - ? -
14 PsiBlast_PDB 78.0519% -62 - C- -3N4U - ? -
6 PsiBlast_PDB 77.8119% -63 - C2 -5C4L - ? -
11 PsiBlast_PDB 77.3219% -62 - C2 -4DT8 - ? -
19 PsiBlast_PDB 76.8719% -62 - C2 -4DFU - ? -
17 PsiBlast_PDB 75.9119% -61 - C2 -4DE4 - ? -
4 PsiBlast_PDB 75.5919% -66 - C2 -4N57 - ? -
72 HHSearch 75.5619% -29 - C2 -5IWU - ? -
5 PsiBlast_PDB 75.5619% -67 - C2 -5C4K - ? -
8 PsiBlast_PDB 75.5019% -65 - C2 -6CD7 - ? -
12 PsiBlast_PDB 75.4119% -60 - C2 -4DT9 - ? -
16 PsiBlast_PDB 75.1819%-111 - C- -4DBX - ? -
20 PsiBlast_PDB 75.0419% -62 - C2 -4DTB - ? -
65 HHSearch 74.5418% -46 - C2 -3TDW 5.2 ?
49 Fugue 70.3716% -24 - C2 -3HAM Error ?