Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KLCKWTVLNSEGEIIESGSCLNTE-YMKHGDIHVEFENDCTPIIFG 5T1X Chain:A ((8-36)) ----------------SGQTLNTDGHLKNGDFDLVMQNDCNLVLY-

General information: TITO was launched using: RESULT: Template: 5T1X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 50 -994 -19.88 -35.50 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -19.88 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.296

(partial model without unconserved sides chains): PDB file : Tito_5T1X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5t1x-query.scw PDB file : Tito_Scwrl_5T1X.pdb: