Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------YECYVSLTINGIEHYKPE-GRMEFPGATTVYDIGGYGTVVIVLGDTCEPIYKTELKLPQAFDFSSRIFKKR-- 2VKJ Chain:A ((1-106)) GSHMNLAVKLTRMEKTLKAYELYIFSDYENFENYVKKEGLKIEGMELLKEKKARSLIAEGKDLFETANYGEALVFFEKALNLSDNEEIKKIASFYLEECRKKLAGD

General information: TITO was launched using: RESULT: Template: 2VKJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 111 387 3.48 5.52 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 3.48 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.63 QMean score : -0.047

(partial model without unconserved sides chains): PDB file : Tito_2VKJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2vkj-query.scw PDB file : Tito_Scwrl_2VKJ.pdb: