Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------KVKKICHYSIQKLHGKTWYQV-GTGQADAGKDTHIEGTKVFFSDQCLPQWNN---------------------------- 2M5J Chain:A ((6-112)) SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVLGAGGNNA

General information: TITO was launched using: RESULT: Template: 2M5J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 108 -891 -8.25 -17.46 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -8.25 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.56 QMean score : -0.040

(partial model without unconserved sides chains): PDB file : Tito_2M5J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2m5j-query.scw PDB file : Tito_Scwrl_2M5J.pdb: