Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YCKLYLMDGGAIQSESFWTKLGSPV--ELLTSPGVSQPIKTDGDCNPKIKGGSPLKKYMITGV 1MS8 Chain:A ((119-180)) --KLYVLVGSYNSSRSYWTSHGDARDWDILLAVGEVTKSTAGGKITASIKWGSPV--------

General information: TITO was launched using: RESULT: Template: 1MS8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 105 3169 30.18 62.13 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 30.18 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.67 QMean score : -0.036

(partial model without unconserved sides chains): PDB file : Tito_1MS8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ms8-query.scw PDB file : Tito_Scwrl_1MS8.pdb: