Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence HECFTTIHAKTPFRSSYSPEYYKASLLQMRPGEDYYFKNPSPFEGCLVKFDEECTQLIWERLFDFP 4PNO Chain:A ((23-47)) ---------------------------------SIYLVNGIKLQGQIESFDQFVILL---------

General information: TITO was launched using: RESULT: Template: 4PNO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 36 -6643 -184.51 -276.77 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -184.51 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.172

(partial model without unconserved sides chains): PDB file : Tito_4PNO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4pno-query.scw PDB file : Tito_Scwrl_4PNO.pdb: