Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------NMIALSRSTLSRPRCNIIIYGLPSGR-NQDRPVMGEADTALNSEVFITVRSGEKYRCTVKDDCDKPTCHELPPHLTYAG--------------- 2EHP Chain:A ((3-126)) AIFTHEGKVEGVPGNYPLTAENLFRIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMN----AGGSVNVGKGGDIKLFLQKGEIYVLEFQP-LSETDIKKLESILFGRAPIPKKTGEDIGSFKC

General information: TITO was launched using: RESULT: Template: 2EHP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 231 10882 47.11 149.07 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : 47.11 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.209

(partial model without unconserved sides chains): PDB file : Tito_2EHP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ehp-query.scw PDB file : Tito_Scwrl_2EHP.pdb: