Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YCKLYLMDGGAIQSESFWTKLGSPV--ELLTSPGVSQPIKTDGDCNPKIKGGSPLKKYMITGV 3OPZ Chain:A ((119-180)) --KLYVLVGSYNSSRSYWTSHGDARDWDILLAVGEVTKSTAGGKITASIKWGSPV--------

General information: TITO was launched using: RESULT: Template: 3OPZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 108 4105 38.01 80.49 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 38.01 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.67 QMean score : -0.025

(partial model without unconserved sides chains): PDB file : Tito_3OPZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3opz-query.scw PDB file : Tito_Scwrl_3OPZ.pdb: