Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KQIAQLKEYLRNPPCKVTIYAPPLKQGQTQLRTVMGFASAGKNEDVPVKIASTGHTYQCRTDATCEEPVCHGLPNGWTYEGVY 1PCH Chain:A ((18-66)) --ASVLAKEASKFSSNITIIAN---EKQGNLKSIMNVMAMAIKTGTEITIQADG-----------------------------

General information: TITO was launched using: RESULT: Template: 1PCH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 167 -22647 -135.61 -462.18 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -135.61 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.265

(partial model without unconserved sides chains): PDB file : Tito_1PCH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1pch-query.scw PDB file : Tito_Scwrl_1PCH.pdb: