Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --AAVLPQLCKVEMFDKNARFVGMARGNWDKDFVIKGHTIKCNTRCETKDVVLPKNWSVKG------- 2KAF Chain:A ((1-67)) GSEEHFVETVSLAGSYRDWSYSG-QRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLS

General information: TITO was launched using: RESULT: Template: 2KAF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 192 4434 23.09 76.45 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : 23.09 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.275

(partial model without unconserved sides chains): PDB file : Tito_2KAF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2kaf-query.scw PDB file : Tito_Scwrl_2KAF.pdb: