Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------SSPAVKFQGYCCKYTIMPGNRVWIVKSGTEHMFEH--------NGKKYNVMAYDRCNLVWPAWGKKGGPEGFTFEYE-------------------------------------- 1XKP Chain:C ((2-127)) QNLLNLAASLGRPFVADQG---VYRLTIDHLVMLAPHGSELVLRTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRY-PQTLVLDDCGQLVLEARLRLQELDTHGLQEVINQLALLEHLIPQLTP

General information: TITO was launched using: RESULT: Template: 1XKP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 139 -3892 -28.00 -59.87 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain C : 0.60 3D Compatibility (PKB) : -28.00 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.60 QMean score : -0.017

(partial model without unconserved sides chains): PDB file : Tito_1XKP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1xkp-query.scw PDB file : Tito_Scwrl_1XKP.pdb: