Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DTNNNRRSCYYTIFHRAGREWRQIRQTITQITPNCVVNNIRGIPKFWVDDDCTPNYQKSEEVYIRVTAEGAKNYPEPPGFPSGCSLRGR 5F0E Chain:A ((534-581)) ------------------AEWDHLKISIP----MCLSLALVGLS-FCGADVGGFFKNPEPELLVRWYQMGA------------------

General information: TITO was launched using: RESULT: Template: 5F0E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 112 -4797 -42.83 -99.94 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -42.83 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.127

(partial model without unconserved sides chains): PDB file : Tito_5F0E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5f0e-query.scw PDB file : Tito_Scwrl_5F0E.pdb: