Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SPDRGLSRMCCVYKIHPGGNIWSTKKGEQAWFRRRFSKYEVMAYDRCNLEWGFSGKPRGLTF 1SE7 Chain:A ((47-64)) -------------------------ENLRTYFMERLRHYRQLS-------------------

General information: TITO was launched using: RESULT: Template: 1SE7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 6 -738 -123.00 -41.00 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -123.00 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.210

(partial model without unconserved sides chains): PDB file : Tito_1SE7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1se7-query.scw PDB file : Tito_Scwrl_1SE7.pdb: