Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GLKDCQVSLTATSEARRSFWDTQYADYNDDVEISAGRHKFVIHVEQGCGGSKVSGTIPPHHL 2GC4 Chain:D ((25-71)) ------------TEAVKHFLETGENVYNEDPEILPEAEELYAGMCSGCHGHYAEGKIGP---

General information: TITO was launched using: RESULT: Template: 2GC4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 69 -2905 -42.09 -61.80 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain D : 0.69 3D Compatibility (PKB) : -42.09 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.69 QMean score : -0.036

(partial model without unconserved sides chains): PDB file : Tito_2GC4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2gc4-query.scw PDB file : Tito_Scwrl_2GC4.pdb: