Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RPCRVDLYEFVHTKPGLTSWSWVHRFNGDARRASLFRAMGYLCSVDYNCKNFHCEKLTSWRW 5J98 Chain:C ((176-213)) -----EVSEFVFTVPYITDTMWWPRKYGGPQAAGEFVAPSYIC-------------------

General information: TITO was launched using: RESULT: Template: 5J98.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 38 -3185 -83.82 -83.82 target 2D structure prediction score : 0.24 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -83.82 2D Compatibility (Sec. Struct. Predict.) : 0.24 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.060

(partial model without unconserved sides chains): PDB file : Tito_5J98.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5j98-query.scw PDB file : Tito_Scwrl_5J98.pdb: