Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence HGGQTFHNELRCIAEFYEHGDISNYFCHPKSDVKPGGVIKCVYRDHPIVVKTDPGCNWKSTAG 5TEF Chain:A ((32-103)) -----------------------NWYCARCSDAVPGGLFGFAARTSVFLVRVGPG--------

General information: TITO was launched using: RESULT: Template: 5TEF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 70 -5961 -85.15 -186.27 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -85.15 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.240

(partial model without unconserved sides chains): PDB file : Tito_5TEF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5tef-query.scw PDB file : Tito_Scwrl_5TEF.pdb: