Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------------WDSPVTHREHRP----APSPPQRCKVEFGRANKPIGQAIEYWDRDFIIQGYTFHCYADCTLKGDYNFPRNQGYWVTS------------------------------------------------------------------------------------------- 4IT4 Chain:C ((6-215)) DWYVGTEWEDKNRGLAKKVIGLQFTEMDKPTIISTVEFSVNKKATNLGGRPSKYLVSTYPQKHSLEMGTSLTAVDCYLELLLQQFVP-GETAACSITTKTGERIEFELKLEKIVKNTQVEKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKKTNGINGQAVEELFIQIQTNLAACLLQEKRYEHVIY

General information: TITO was launched using: RESULT: Template: 4IT4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 138 9723 70.45 135.03 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain C : 0.57 3D Compatibility (PKB) : 70.45 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.160

(partial model without unconserved sides chains): PDB file : Tito_4IT4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4it4-query.scw PDB file : Tito_Scwrl_4IT4.pdb: