Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------RDCRLYYCWGPGSDNRRVVGTVDKGGSWKDYVN---GETITVKAGKDCKAEIIGGKTCDMMPSF--SWCLVNA----- 5A6W Chain:C ((11-93)) RAIDLSRERDPNFFDHPGIPVPECFWFMFKNNVRQDAGTCYSSWKMDMKVGP-NWVHIKSDDNCNLSGDFPPGWIVLGKKRPGF

General information: TITO was launched using: RESULT: Template: 5A6W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 204 11114 54.48 165.88 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain C : 0.64 3D Compatibility (PKB) : 54.48 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.435

(partial model without unconserved sides chains): PDB file : Tito_5A6W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5a6w-query.scw PDB file : Tito_Scwrl_5A6W.pdb: