Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------GAIVKAKCPYTAFMHRNAKLKPVI----------YGEADANSEEQISFAKVKFAPD---CKILESSGGK 5LSI Chain:D ((50-131)) GITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNG-

General information: TITO was launched using: RESULT: Template: 5LSI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 77 4053 52.64 73.69 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain D : 0.60 3D Compatibility (PKB) : 52.64 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.60 QMean score : -0.011

(partial model without unconserved sides chains): PDB file : Tito_5LSI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5lsi-query.scw PDB file : Tito_Scwrl_5LSI.pdb: