Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------------------------------------PCVITID------GPYNPKYNFYPSHGRGVTGPHGQVVIGDF-----TCTVGATCNQLTCNAPQPEYSILGVDS------- 4RFU Chain:A ((7-123)) APIMTQGSLYNDSLSTNDFKSILLGSTPLDIAPDGAVFQLDRPLSIDYSLGTGDVDRAVYWHLKKFAGNAGTPAGWFRWGIWDNFNKTFTDGVAYY----SDEQPRQILLPVGTVCTRVDS

General information: TITO was launched using: RESULT: Template: 4RFU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 118 -894 -7.58 -15.15 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -7.58 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.361

(partial model without unconserved sides chains): PDB file : Tito_4RFU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4rfu-query.scw PDB file : Tito_Scwrl_4RFU.pdb: